KEGG   Synechocystis sp. PCC 6803: slr1538
Entry
slr1538           CDS       T00004                                 

Gene name
cbiD
Definition
(GenBank) CbiD protein
  KO
K02188  cobalt-precorrin-5B (C1)-methyltransferase [EC:2.1.1.195]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00860  Porphyrin and chlorophyll metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    slr1538 (cbiD)
Enzymes [BR:syn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.195  cobalt-precorrin-5B (C1)-methyltransferase
     slr1538 (cbiD)
SSDB
Motif
Pfam: CbiD
Other DBs
NCBI-ProteinID: BAA17463
CyanoBase: slr1538
CYORF: slr1538
UniProt: P73423
Position
976748..977842
AA seq 364 aa
MFACASAIAAVETLLTSNCPDSVTLELLEPARTAEIAIEQGALLGHHRALAITRSEPGNN
LDLTRHTPVWAEVEFTPGEGKLIIQGGEGIGKQLDREGQAAIYSYAQRLLRHHLQPYISG
DQTLMVSLILPLGRTLATRTSNAAFGVVEGLSLLGTSGIAQPLSAPEQLAEFQQHLTSAA
QQHQCLVFCLGENGLDLARQWGVPLDQMVKTANWLGSLFVAAAAVGVQEILLLGYHGKLI
KLAGGIFHTHHHLADGRLEILTAQAVQAGLPYPLVQELGQAPTTEAGLKLLRHWQTEQNC
PWVSKIYQAMADTVDRRSEEYVYKVSQHQLKVGSLLFDGDRQPVAISTQGQAMADKLGMT
IPET
NT seq 1095 nt   +upstreamnt  +downstreamnt
gtgtttgcctgtgcgtcggcgatcgccgctgtggaaaccttgctcactagtaactgtcca
gattcggtcacgctggaactattggaaccggctagaacggcggaaattgccattgaacag
ggggctttgctcggtcatcacagagccttggccatcacccgcagcgaaccgggcaataac
ttggatttaactcgccatacccccgtttgggcggaagtggaatttaccccaggggaagga
aaactgattattcaagggggagaaggcattggcaaacagcttgatagggaaggccaagcc
gccatttacagctatgcccaacgattattaagacaccatttgcagccgtacataagtgga
gatcaaactctgatggtttccttaattttgccccttggtcgaaccttagccactcgcaca
tccaatgcagcttttggggtggtggaaggtctatctttgttaggcaccagcggcattgcc
caacccctcagtgctccggagcaactggcagagtttcaacagcatttgactagtgcggct
caacaacatcaatgcttagtattttgcctgggagaaaacggtttagacttagctcgacag
tggggagtacccctagaccaaatggtaaaaacggccaattggttaggctccctttttgtg
gcggcggcggccgtgggggtacaggaaatcttgctcttgggttaccacggcaaattgatc
aaactagccgggggcattttccacacccatcaccatttagccgatggccgtttggaaatt
ctcactgcccaagctgtacaagcaggtttaccctatcccctggtacaggaacttggccaa
gcacccaccacggaagcagggttaaagctattacgccactggcaaacggagcaaaattgt
ccttgggttagcaaaatttaccaagccatggcggacaccgtcgatcgccgttcggaggaa
tatgtttataaagtcagtcaacatcaattaaaagtgggcagtttactatttgatggcgat
cgccaaccggtggcaattagtactcaaggtcaggccatggctgataaattggggatgacc
ataccagaaacttag

DBGET integrated database retrieval system