KEGG   Synechocystis sp. PCC 6803: slr1540
Entry
slr1540           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Epimerase NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NmrA 3Beta_HSD Glyco_transf_4 adh_short RMMBL CbiJ
Other DBs
NCBI-ProteinID: BAA17464
CyanoBase: slr1540
CYORF: slr1540
UniProt: P73424
Position
977932..978867
AA seq 311 aa
MRILIMGGTRFIGIHLCRVLVAQGHEVVLFNRGNRPDPVNGVAQIHGDRRVAEQLREKLE
KEEFDVIFDNNGRELSDTQPLVDLYNGRVQQFVYMSSAGVYQASSQMPHRETDAVDPQSR
HKGKFETERYLAQSGIPWTAIRPTYIYGPHNYNALESWFFDRLVRGRAIPIPGNGQYITQ
LGHVEDLAIAMAKTIVTPAAIGQIYNISGDRYVTMNGLAQACATAAGLDPQGVKLVHYDP
KDFDFGKRKAFPLRQQHFFADIQKAQDHLDWHPNYGLVEGLKNSFQLDYLPSGKGEEKGD
FDLDEQILAFS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcgcattttaattatgggaggaacccgttttatcggtatccatctctgccgggtgctg
gtggcccaaggtcatgaagtggtcctattcaatcggggaaatcgtcctgaccccgtcaat
ggcgtggcccaaatccatggcgatcgccgggtcgctgaacagttgcgcgaaaaactagaa
aaggaagaatttgacgtaatttttgacaacaacggtcgggagttgagcgatacccagccc
ctggtggacttgtacaatggccgagtacagcaattcgtttacatgagttccgctggggtt
taccaagcatcatcccaaatgccccaccgggagaccgatgcggtggatccccagagtcgc
cacaaaggcaaatttgaaacggaacgctatctagcccagagcggcattccctggactgcc
atccgccccacctatatttacggtccccacaattacaatgccctcgaatcctggtttttt
gaccgtttagtgaggggtcgagccattcccatccccggtaatggtcaatacatcacccaa
ctgggccatgtggaagatttggcgatcgccatggccaaaaccattgttaccccagcagcg
atcgggcagatttataacatctccggcgatcgatacgtcaccatgaatggtctagctcaa
gcctgtgccaccgcggcgggtcttgatccccagggcgttaaattagtccactatgacccc
aaggattttgactttggtaaacgcaaagcttttcccctgcgtcaacaacacttttttgcc
gatattcaaaaagcccaagaccatttagattggcatcccaattatggtttagtagaaggc
ttaaaaaatagctttcaactggattatctgccgtccggtaaaggggaggaaaaaggagat
tttgacctagacgagcaaatcctggcattcagttaa

DBGET integrated database retrieval system