KEGG   Synechocystis sp. PCC 6803: slr1541
Entry
slr1541           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF3782 LRRFIP DUF4200 MPS2 MCPsignal
Other DBs
NCBI-ProteinID: BAA17465
CyanoBase: slr1541
CYORF: slr1541
UniProt: P73425
Position
978941..979573
AA seq 210 aa
MATTADEVWALLGELIESQKETDRRMQETDRRMKLTDLQMQETDRRMQETDRLIKENGRF
IKELGKQIGGLGKKFGSFTEGLALPSMERILQERFGMEVISPSVRASKGGQHLEIDVLAY
ANSDINTAYVVEVKSHPREESITQLKNLLQKFRTFFPEHKDKKLYGILAAVDWSDDLKQQ
ALREGLYVASIHDEVFELAETPPDFEPKLW
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccaccactgccgatgaagtttgggccctactgggggagttgattgaatcccagaaa
gaaactgatcgccgtatgcaagagaccgatcgccgtatgaaattaacggatcttcaaatg
caggagaccgatcgtcgtatgcaagagaccgatcgacttatcaaagaaaacggtcgcttt
atcaaagaactggggaaacaaattggtgggttagggaaaaaatttggtagttttaccgaa
ggcttggccttgccttccatggagcgcattctgcaggagcgttttggcatggaagttatt
agtcctagtgtcagggccagcaaaggagggcaacacctagaaattgacgttctagcctat
gccaacagtgacattaataccgcttacgtggtggaagtaaaaagccatcccagggaagag
tccattacccaactaaaaaatttgctccagaagtttcgtaccttctttcctgaacacaaa
gataaaaagttgtatggcattctggcggcggtggattggtcagatgacttaaagcaacag
gcgttacgggagggtttatatgtggccagcatccacgatgaagtttttgagttggcagag
actccacctgattttgagcctaaactctggtaa

DBGET integrated database retrieval system