KEGG   Synechocystis sp. PCC 6803: slr1543
Entry
slr1543           CDS       T00004                                 

Definition
(GenBank) DNA-damage-inducible protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: MatE Polysacc_synt_C Spore_III_AE
Other DBs
NCBI-ProteinID: BAA17467
CyanoBase: slr1543
CYORF: slr1543
UniProt: P73427
Position
980276..981694
AA seq 472 aa
MNFDRIFAWPLTSLEVFMNLALPSQYQFLPRFFRLATIAVLSNMMVPLAGLVDTAFLGHL
EDIDYLAGVILGSILFDYLYRVLKFLRTSTTALTAQAVGEEDQAEVWVAGLRSALVALLL
GLGILALQYPLQKFGFALLTGAPGVEQSGMDYFYGRIWGAPAVLLNFVILGWLLGQERNG
LVLLISLVANFSNVGLDYLMINRWGWASAGAGWATASSQYLALALGLISIVVLAQGEKEK
GEFKAAIAKLSDWGALRATIALKGNILIRFVILITTYSLFTNISSSFGTEVLAQNGLLLQ
IALLSQFTIQGVGMTSQTLTGNFKSKGEYQLLLPVLLTAIVTTLLMALGFAAVAIAFPET
LFGLLTNHAEINDSVRQYTIWLIPLLESTALAFMLEAYFIGLKASQPLRNGVLFAFFGIY
LPCLGLAIWQQSNNLLWFSLVSYMLGLVVYLGWQLLTRFSPQTLALESKQPS
NT seq 1419 nt   +upstreamnt  +downstreamnt
gtgaattttgaccgcatttttgcttggccgctgaccagtttagaagtctttatgaatctt
gccctgcctagccagtatcaattcttaccccgtttttttcgcctagccaccattgctgtc
ctttccaatatgatggtgcccttagctgggttagtggacaccgcttttttgggccatcta
gaagacattgattatttagcaggggtgatcctcggctcgattttgtttgattacctctac
cgggtcctaaaatttttacgcaccagcaccaccgctctcacggcccaagctgtgggggaa
gaagaccaggcggaggtatgggtggcgggactaagaagtgccttggtagccctattgttg
ggtttgggcattttagccttgcaatatcccttgcaaaaattcggttttgccctgttaact
ggggctccaggggtggagcagtcgggtatggactatttttacggccggatttggggggct
ccggcggtgctgctcaattttgtcatcttgggctggctattgggacaagaacgcaatggt
ttagttttgctcatttccctggtggctaatttttccaacgttggtctggactatttgatg
attaaccgttgggggtgggctagtgcgggggccggttgggccactgccagtagtcagtat
ttagctctggccctaggtttgatctccattgtggttctagcccaaggggaaaaagagaag
ggagagtttaaagcggcgatcgccaaattatcggactggggagcgttgcgggccaccatt
gctctgaaagggaacatcttgatccgttttgtgattttaatcaccacctattctttgttt
actaatatcagttccagctttggcacggaagtcttggcccaaaacggtctgctgttacaa
attgccctgcttagccaattcaccatccaaggggtgggcatgaccagccaaaccctgact
ggtaatttcaagagtaaaggggaatatcaattgttattgccggttttactcaccgccatc
gtcaccaccctattaatggccctgggctttgccgctgtggcgatcgccttccccgaaacc
ctattcggactgttaaccaaccatgcagaaatcaacgacagcgtccgtcaatacaccatc
tggctgattcccctgttggagagcaccgccctggcctttatgctggaagcctatttcatc
gggcttaaagcgtcccaaccccttaggaacggagtgctgtttgccttcttcgggatctat
ttaccctgccttgggctagccatctggcaacagagcaataatctgctgtggttctccctg
gtctcctacatgttgggcctagtggtttatctgggctggcaattacttacccgattttca
ccgcaaactctagctctggaaagcaaacaacctagctag

DBGET integrated database retrieval system