KEGG   Synechocystis sp. PCC 6803: slr1544
Entry
slr1544           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA17470
CyanoBase: slr1544
CYORF: slr1544
UniProt: P73430
Position
983229..983540
AA seq 103 aa
MNYQRTALGTVKIEQIRGKTMNADTDIYQNKDLFAPVVFRKDFNQFAPINGNQAWSLFFT
AGQEDKQLGNSPEFGRFFTNTLFAIGAATFIWGYFFSRWADFL
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaactaccaaaggactgcccttggcaccgtgaaaatcgaacaaataagaggtaaaact
atgaacgccgacactgatatttatcaaaacaaagatctatttgcccccgttgtcttccgc
aaagacttcaaccaatttgcccccatcaacgggaaccaagcctggtctttatttttcacc
gccgggcaagaagataagcaactgggcaacagccctgaattcggtcgctttttcaccaat
actctcttcgccattggggctgccactttcatctggggttacttcttcagccgttgggct
gactttctctaa

DBGET integrated database retrieval system