KEGG   Synechocystis sp. PCC 6803: slr1545
Entry
slr1545           CDS       T00004                                 

Gene name
rpoE
Definition
(GenBank) RNA polymerase sigma-E factor
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:syn03021]
    slr1545 (rpoE)
Transcription machinery [BR:syn03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     slr1545 (rpoE)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF GerE HTH_24 HTH_AsnC-type HTH_23 HTH_28 HTH_10
Other DBs
NCBI-ProteinID: BAA17471
CyanoBase: slr1545
CYORF: slr1545
UniProt: P73431
Position
983804..984475
AA seq 223 aa
MLGKSMNQAVNTNWAIESGGGKLSALPPESLTNVDLILLCQQKTRPDSTAFNELLRRYQS
HVDKILYHLAPDWQDRADLAQEVWIRVYRNIHRLNEPVKFKGWLSRIATNLFYDELRKRK
RVSHPISLDAPRRMDDGEIDWDIESDYPSPDETLSTAEFYECLRSAIKDLPEAFRTTIIL
REIDGLAYEEIAEITGVSLGTVKSRIARARAKLQTFLQPYLAS
NT seq 672 nt   +upstreamnt  +downstreamnt
gtgttgggtaaatccatgaatcaagccgtcaataccaactgggcgatcgagagtggcgga
ggcaaactaagtgccctgcccccggagtcgttaaccaatgttgacctgattttgctctgt
cagcaaaagacccgtcccgatagtaccgcttttaatgagttgctccggcgttaccagtcc
catgtggataaaattctttatcacttggcccccgactggcaggaccgggcggacttggcc
caggaggtttggattcgggtttaccgtaacatccatcgcttaaacgaaccggtcaaattt
aagggttggctcagccgcattgccactaacctcttctacgacgagttacgcaagcgcaaa
cgggttagtcatcccatttcccttgacgctccccggcgcatggatgacggcgaaattgac
tgggacattgaatctgattaccccagtcccgatgaaactttatccactgctgaattttat
gaatgtttgcgttcggccattaaggacctacctgaagctttccgcaccaccattatcctg
cgggaaattgacggtttagcctacgaagaaattgccgaaatcaccggggtttccctcggg
acggttaaatctcgcattgcccgggcccgggcgaagttgcaaacttttttacagccctat
ttggcttcctaa

DBGET integrated database retrieval system