KEGG   Synechocystis sp. PCC 6803: slr1552
Entry
slr1552           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: ITAM_Cys-rich
Other DBs
NCBI-ProteinID: BAA17486
CyanoBase: slr1552
CYORF: slr1552
UniProt: P73446
Position
999029..1001563
AA seq 844 aa
MWRYRSPEMPLTESFLDLMLIPIIGFGLAVILLIGFFLLYQEVGIFKNLKFLVIRKNNPF
FILALFCLITGLALGLVGYWGILEPKLGAADLQALRRNLIILSLLLFGVTFRQYLFDLIK
PVTTMAIWRKIGTFNYKNRIAILTYVLLGLIALAWMAPMASTKIIFSINDHTSHIGYIVQ
GRMALEEGQFPLRVAPLENFGFRYPGFQFYSQLPYFFGAIIYKFLTPTNPYTAYKILLWS
ALWLGGIFIYRVGFFFTRSQIAAILGGVTYMSAPYFLNNVHARGAFTEAIAQGILAIVLF
YAIQTFYYPHYRHLILGALAWCALGLTHIITFVYTTIFIALLGAIFLVKNKPNHWQKGIT
YISLSYIWAWLLALYFLAPVALESGSLAIRRQIQAINPFNTTDITPIANLLAPNSLPHQP
TELGIAPTYGFHPAVGWILLAGFGTVIYFVFAGKSLPRRLWRSQPWLIPLLSVFILALFL
TWSPVNIWNLLPRQLWVTQFTFRFLTHVMWSGALLTTLAIILIFRERLRSRHLILGILII
VIASRPWLPIPRGTVTVEELLQDPLFRYSGALDYLYRLPNKAVPVNTKAQSAVEKIYGKA
ELQLLHPDWIPGYLSWDVFINGPLPIDVDIPYPAWPETEKPTLVLQGRVPMDKIKSQANL
IVFVDQQPLTSIPLTQEELKVKVPFTDVKFAGNAFELKFIVEGETTDGNPLYIRMNHLYF
DDFSAANTLLPVHATKEMCNQKGVVTNCPVEMPAEAGTVQLPILYYPAMQQVVVDNQPVK
GFFTNYRDFNLLSLNLSPGKHQIQVKFTGLIWANFISLLAWLTLIITAIALKFYPRKPEQ
TIFK
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgtggcgttatcggtcacccgaaatgcccctaactgagtcattcttggatctaatgcta
attcctataatcggttttggtttggctgttattttattgattggattttttctgctctat
caggaagtcggcatttttaaaaacttaaaattcctcgttattcggaaaaataaccccttt
tttattcttgctttattttgtcttattacaggcttagctttaggattagtgggctattgg
ggcattctagaaccaaagcttggtgcggctgatttacaagccttaagacgtaatttaatc
atcttgagtttattactttttggggtaacgtttcgtcaatatttatttgatttgattaaa
cccgttaccaccatggcaatttggcgaaaaattggcacttttaactataaaaatcgtatt
gccattcttacctatgttttgctagggctaattgctttggcttggatggcccctatggca
tcgaccaagataattttctccattaatgaccacacttcccacatcggctacattgtccaa
gggcgaatggccctagaggaaggacaatttcccctacgggtggcccctctagaaaatttt
ggtttccgttatcctggatttcaattttatagtcaacttccctattttttcggggcaata
atttacaaatttttgactcccactaatccctacactgcctataaaattttgctttggtct
gccctatggttgggggggattttcatctatcgggttgggtttttcttcacccgttcccaa
attgccgctattttagggggagtgacctatatgtccgccccctattttcttaataatgtc
catgcaaggggagctttcaccgaggcgatcgcccagggaattttagccattgttttattt
tatgctattcaaactttttactatccccattatcgccatttaattttaggtgctttggcc
tggtgtgccctgggattaacccatattatcaccttcgtttacacaactatttttattgct
ttattaggtgccattttcttagtcaaaaataagcctaatcattggcaaaaagggattact
tacattagtttgagctacatctgggcttggttgctagcgctttactttttagctcctgtg
gctctggaatctggcagtttagccattcgtcgtcagattcaagccattaatcccttcaac
actaccgatattaccccgatcgccaatttactagcccccaattctctgcctcaccaacca
acggaactgggcattgcccctacctacggttttcatcccgctgtcggttggattcttttg
gctggctttggcacggtaatttactttgtttttgctggcaaatcattacctaggcgttta
tggcgatcgcagccctggctgattcctttgctgagcgtatttatactagccttatttctt
acgtggagtcccgttaatatttggaatcttttgccccgacagttgtgggtcacccaattt
acttttcgttttttaacccatgtaatgtggtccggggcactgctaaccacactggcaatt
attttaatttttcgagaaagattacgcagtcgtcatttaattttaggtattttaattatt
gtcattgctagccgcccttggttacccataccccgaggcacagtgacagtagaagaatta
ttacaagatcccctttttcgttattctggcgctttggactatctctatcgcttacccaac
aaagccgttcctgttaacacaaaagcccaatcagcggtggaaaaaatatatggcaaagcc
gagttgcaacttctccatcccgattggattcccggctatctttcctgggatgtatttatt
aatggccccctacccattgacgttgatattccctatcctgcctggccagaaacggaaaaa
cccaccctagttttacagggtagagttcccatggataaaattaaaagccaagctaattta
atagtttttgttgatcaacaaccattaacttccattcctttgacccaggaagaattaaaa
gtaaaagttcctttcaccgacgttaaattcgctggcaacgcctttgaattaaaatttatc
gtagagggagaaaccactgacggcaatcctctttacatcagaatgaatcatctatatttt
gatgatttttccgccgcaaatacccttctacctgtccatgcaactaaggaaatgtgtaac
caaaagggagttgtgactaactgcccagttgaaatgcccgcagaggctggcacagtgcaa
ctgccaattttgtattatcctgcaatgcaacaagtcgtggtagataatcaaccagtaaaa
ggattttttactaattatcgagattttaatttactcagtcttaatctgagtccaggcaaa
catcaaatccaagtcaaattcaccggcttaatctgggcaaactttatcagtcttcttgct
tggttgacattgatcattacggcgatcgccttaaaattctatccacgtaaaccggagcaa
acaatttttaagtag

DBGET integrated database retrieval system