KEGG   Synechocystis sp. PCC 6803: slr1556Help
Entry
slr1556           CDS       T00004                                 

Gene name
ddh
Definition
(GenBank) 2-hydroxyaciddehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00620  Pyruvate metabolism
syn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    slr1556 (ddh)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     slr1556 (ddh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 CoA_binding_2 Rossmann-like IlvN Imm40 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAA18694
CyanoBase: slr1556
CYORF: slr1556
UniProt: P74586
Position
3359578..3360579
Genome map
AA seq 333 aa AA seqDB search
MKIAFFSSKAYDRQFFQQANHPHQREMVFFDAQLNLDTAILAEDCPVICLFVNDQAPAPV
LEKLAAQGTKLIALRSAGYNNVDLKTAADLGLKVVHVPSYSPHAVAEHTVGLILALNRKL
YRAYNRVRDDNFSLEGLLGFDLHGTTVGVIGTGKIGLAFAQIMNGFGCHLLGYDAFPNDK
FTAIGQALYVSLNELLAHSDIISLHCPLLPETHYLINTNTIAQMKPGVMLINTSRGHLID
TQAVIQGIKSHKIGFLGIDVYEEEEELFFTDHSDTIIQDDTFQLLQSFPNVMITAHQGFF
THNALQTIAATTLANIAEFEQNKPLTYQVICPH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgctttttttagcagtaaagcctatgatcgtcaatttttccaacaagcaaac
cacccccatcaacgggaaatggtcttttttgatgcccaactcaaccttgataccgctatt
ttagcggaggattgccccgttatttgcctcttcgttaatgaccaagctcctgccccggtg
ctagaaaagttagctgcccagggcacaaaattaatcgctctgcgcagtgcgggctataat
aatgttgacctcaaaacagccgcagatctggggctaaaagtagtccatgtaccatcctat
tctccccatgcagtcgcagaacatactgtggggttaattctggctctaaatagaaagtta
tatcgagcctataaccgcgttagggacgataatttttccctagaagggttacttggtttt
gatctccatggcaccaccgtcggagtgattggtactggcaaaattggtctagcttttgct
caaattatgaatggttttggctgccatttattgggctacgatgcctttcctaacgataaa
tttactgccattggccaagccctctatgtatctttaaatgaacttttagctcattctgat
attatttctctccactgtcccctactgccggaaacccattatctaattaacactaatacc
attgcccaaatgaagccaggggttatgttaatcaacacaagtcgaggtcatttaattgat
acccaagcggttattcaggggattaaatcccataaaattggctttttaggcattgatgtt
tacgaagaagaggaagagctattttttactgaccattctgatactatcattcaagatgat
acctttcaattgctacaatcttttcccaatgtaatgatcacagctcatcagggattcttt
acccacaacgctctgcaaaccattgccgcaacgacactggcaaatattgctgaatttgag
cagaataaacctttaacttaccaagtaatctgtccccattaa

DBGET integrated database retrieval system