KEGG   Synechocystis sp. PCC 6803: slr1643Help
Entry
slr1643           CDS       T00004                                 

Gene name
petH
Definition
(GenBank) ferredoxin-NADP oxidoreductase
  KO
K02641  ferredoxin--NADP+ reductase [EC:1.18.1.2]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00195  Photosynthesis
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    slr1643 (petH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syn00194]
    slr1643 (petH)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     slr1643 (petH)
Photosynthesis proteins [BR:syn00194]
 Photosystem and electron transport system
  Photosynthetic electron transport
   slr1643 (petH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 CpcD FAD_binding_1 FAD_binding_6 NAD_binding_6 PRC
Motif
Other DBs
NCBI-ProteinID: BAA18459
CyanoBase: slr1643
CYORF: slr1643
UniProt: Q55318
Position
2067522..2068763
Genome map
AA seq 413 aa AA seqDB search
MYSPGYVATSSRQSDAGNRLFVYEVIGLSQSTMTDGLDYPIRRSGSTFITVPLKRMNQEM
RRITRMGGKIVSIKPLEGDSPLPHTEGIAKPSQSEGSGSEAVANPAPESNKTMTTTPKEK
KADDIPVNIYRPKTPYIGKVLENYPLVREGAIGTVQHLTFDLSAGDLRYLEGQSIGIIPP
GEDDKGKPHKLRLYSIASTRHGDFGDDKTVSLCVRQLEYQNEAGETVQGVCSTYLCNIKE
GDDIAITGPVGKEMLLPPDEDANIVMLATGTGIAPFRAFLWRMFKEQHEDYKFKGLAWLI
FGIPKSENILYKDDLEKMAAEFPDNFRLTYAISREQQNAEGGRMYIQHRVAENAEELWNL
MQNPKTHTYMCGLKGMEPGIDEAFTALAEQNGKEWTTFQREMKKEHRWHVETY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtcccggttacgtagcgacttcatcccgccagagcgatgccggtaatcgttta
ttcgtttatgaggtaatcggcctgagtcagagcaccatgactgatggcttagactatccc
atccgccgtagtggcagcacgttcatcaccgtccccctaaagcggatgaaccaagaaatg
cgacgcattacccggatgggaggaaaaattgtcagcattaagcctctagagggagattcg
cctttaccccacaccgagggcattgctaaacccagtcaatccgagggaagtggttcagaa
gcggtggctaatccagcccctgaatctaacaaaaccatgacaacaacccccaaagaaaaa
aaagctgacgatattcccgtcaatatttatcgtcccaaaactccctacatcggcaaagtt
ttagaaaattatcctttggtaagggaaggggccattggcacagtacaacacctcacgttt
gacctctccgctggggatctccgttacctagaagggcaaagtatcggtatcattcccccc
ggggaagatgataagggcaaaccccataagttgcgcctgtattccattgcttccaccaga
cacggtgattttggcgacgacaaaaccgtttccctctgtgtgcgccaattggaatatcaa
aacgaagccggggaaaccgtacaaggggtctgctccacctacctgtgcaacatcaaggaa
ggggacgacattgctattactggccccgttggcaaggaaatgctcttacccccagacgaa
gatgccaacattgtgatgctggccaccggcaccggcattgcccccttccgggccttcctg
tggcgtatgttcaaggaacaacacgaagattacaaatttaaaggcctagcttggctcatc
tttggcattcccaaatcagaaaatattctctataaagatgatttggaaaaaatggcagcg
gaatttcccgataatttccgcttaacctatgccatcagccgggagcaacaaaatgcggag
ggcggccggatgtatatccagcaccgggtggcggaaaatgctgaagaactgtggaatttg
atgcaaaaccccaaaacccacacttatatgtgtggtctcaaaggcatggaacccggcatt
gatgaagcgttcactgccctagcggaacaaaatggcaaggagtggaccactttccaacgg
gaaatgaaaaaagagcaccgctggcacgtggaaacctactaa

DBGET integrated database retrieval system