KEGG   Synechocystis sp. PCC 6803: slr1724Help
Entry
slr1724           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3153
Motif
Other DBs
NCBI-ProteinID: BAA17915
CyanoBase: slr1724
CYORF: slr1724
UniProt: P73856
Position
1478988..1479782
Genome map
AA seq 264 aa AA seqDB search
MLFAHEASRMMCPQKWFKRLLPMVLGVCCLLTGCVDYDVGIRFPEQHYGEIVQHITLGEQ
LTTLSQAEADRWLKSLDQRAKDLNGHTDRPSEETLVITIPFGSGQELVEKFNRFFNPQPP
KGRRSPEPDQLDLLNLKAELALEQSNWLLADRNHLKLTVDLRALGVLSNQGNIILSPGSL
INLNFDLQTPLTLQTPNAPGEELGTEVPGQWQLKPGQINVIETTFFVPSYLAIGTILIII
LCLGGFYLKYGRWPGVLDSKVEGV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttatttgcccatgaggcttccaggatgatgtgcccccagaaatggtttaaacgatta
ttacccatggttttgggtgtttgctgtttgctaaccggctgtgtggattatgacgtgggc
attcgttttccagagcaacattatggggaaattgtccaacacattaccctgggggaacaa
ctaactaccctgagccaagcagaagccgatcgttggctcaaaagtttagaccagcgggct
aaggacttaaacggtcacacggatcgcccgtcggaggaaacccttgtgataaccattcct
tttggtagcggccaggagttggtggaaaagttcaatcgcttttttaatccccaacccccc
aaaggaaggcgatcgccagagccagaccagttggatttgcttaatttgaaagcggaactc
gcactagagcaaagtaattggttattagcagaccgcaatcatctcaagttaaccgttgac
ctgcgggccctaggggttttatccaaccaaggcaacattatccttagtcccggctcccta
attaacctcaattttgatttgcaaactcccttaactctccaaactcccaatgctccgggg
gaagaattaggcacagaagtgcctgggcaatggcagttaaaacctggacaaattaacgtt
attgaaacgaccttttttgtgcctagttatttggcgatcgggacaattttaattatcatc
ctttgtttagggggtttttatctcaaatatggccgttggcccggagtgcttgatagcaaa
gttgagggagtttaa

DBGET integrated database retrieval system