KEGG   Synechocystis sp. PCC 6803: slr1727Help
Entry
slr1727           CDS       T00004                                 

Definition
(GenBank) eukaryotic Na+/H+ exchanger
  KO
K03316  monovalent cation:H+ antiporter, CPA1 family
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    slr1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger DOG1
Motif
Other DBs
NCBI-ProteinID: BAA17925
CyanoBase: slr1727
CYORF: slr1727
UniProt: P73863
Position
1488843..1490426
Genome map
AA seq 527 aa AA seqDB search
MDTAVNESLSISYNLEQFLIVLSVSLSIATLSKTVPILRKIPYTLLLVIVGMALAFVDVK
LINLSPELIMEIFLPPLLFEAAWNLQWRNLKENWFPITLFATLGVVICVVGIAFPLSYWG
GMELAIAFLAAAALSATDPVSVIALFKELGASKKLNTLMEGESLFNDGVAVVVFLILVGI
PLGTSTFDLSVTLARFVTVIGIGVGCGLVIGFSLSLLTQRFDLPFVEQSLTLVSAYGAYI
LAENLGGSGVIGVVVVGMVLGNYGSRIGMNPRTRLIVSIFWEFVAFFVNSIIFLLIGDQI
GLSSLSDHLNLILIAIAAVVVTRLVSVFGLSLISNKVSDQISSTHITLQEQTVLWWGGLR
GSVAIAVALSVPQAIAERQAIIDIVFGVVLFTLLVQGLTTQFVLKGLDLIGDQPQRLEYA
ELVSRQIALRRVLAELEKTDEFPDINPERLRYKQELVQGQLQSVTDKLKLLLQEYPLLQE
VANKKFDQTVLDIEAETYADLIRMGRLEENIMPLLVTLEGENVAEPS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtggatacagcggtcaacgaatccctctcgatttcctataacttagaacagttcttgatt
gtgctctcggtctccctgagcattgcgaccctgtccaagacggtgccaattctgcggaaa
attccctacaccctgctgttggtaattgtgggcatggccctggcctttgtcgatgtgaaa
ttgatcaatctgtcgccggaattgatcatggaaatttttctgcctcccctactgtttgag
gctgcgtggaatttacagtggcgcaatctcaaagaaaattggtttccgattactctcttt
gccactttgggagtggtcatctgtgtggtgggcattgcctttcccctttcctattggggg
gggatggagttggcgatcgcctttttggccgcggcggccttgtctgctacagatccagtg
tcggtgattgccctatttaaagagttgggggcgagcaaaaaactaaatacgttaatggaa
ggggagagcctatttaacgatggggtggcggtggtggtcttcctcattttggtgggcatt
cccctaggcaccagcacttttgacttgtccgttaccctcgctcgatttgtcaccgtgatc
ggcattggggtgggctgtggcctggtgattggctttagtttgtccctgttgacccaacga
tttgacctaccttttgtggaacagtccctcaccctggtgtcggcctacggtgcctatatt
ctggcggaaaacctggggggatcgggagtaattggggtggtggtagtgggcatggtgttg
ggcaactatggttcccgcattggcatgaatccccgcaccagactgattgtcagcattttt
tgggaatttgtggccttctttgtcaattccattatcttcttactgattggggatcaaatt
ggcttgagcagtctttcggaccacctcaacctgattttgattgccattgctgcggtggtg
gtgactcgcttagtgagtgtttttggtctgagcttgatcagcaacaaggtgagtgaccag
attagtagtacccacattactctccaggaacaaaccgtactctggtggggcggattgcgg
ggttccgtcgccattgccgtggccctgagtgtgccccaggcgatcgccgagagacaggcc
atcatcgacattgtctttggtgtggtgctattcaccctactggtgcaaggactgactacc
caatttgtgctcaaaggcctagatttaattggcgatcaaccccaacggttggaatatgca
gagctagtatcccgacaaattgccctacggcgggtgttggcggaactggaaaaaaccgat
gagtttcccgacattaacccagagcggttgcgttataagcaggaattagtccaaggacaa
ctgcaaagcgtcaccgacaaactcaaactgctcctgcaggaatatcccctattgcaggaa
gtggccaacaaaaaattcgaccagacggtactagatatagaggcggaaacctatgccgat
ttaattcgtatgggtcgcttggaggagaatattatgcctttactggtcaccctggaaggg
gaaaatgtggccgaaccatcctag

DBGET integrated database retrieval system