KEGG   Synechocystis sp. PCC 6803: slr1748
Entry
slr1748           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00860  Porphyrin and chlorophyll metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    slr1748
Enzymes [BR:syn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     slr1748
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: BAA17494
CyanoBase: slr1748
CYORF: slr1748
UniProt: P73454
Position
1011975..1012619
AA seq 214 aa
MALKLYFLRHAQTAYSATGGYCGTPENDPGLTPEGILMAKEFAEAYAQHPWQAVYVSPLQ
RARQTVQPLCDRLGIEMQIRPGLREVAYGEWEGLHPDEVYQRDHDLYMQWLTDPAWNSPP
GGERGIDIARRGTRVLEEIEDRFDDGNVLLVSHKATIRILLCCLLGIDVGRYRDRFAMPV
TGLSVVELSSRGPLFHCIAERSHLSPYLRSLPST
NT seq 645 nt   +upstreamnt  +downstreamnt
atggccctcaaactttatttcctgcgccacgcacaaaccgcctacagtgccaccggaggc
tattgtggtaccccggaaaatgaccctggcttgaccccagaaggaattttaatggccaag
gaatttgctgaagcctacgcccaacacccctggcaagcagtttatgttagccctttgcaa
cgggcccgccaaacagtccaacccctatgcgatcgcctaggtattgaaatgcagatccgc
cctggcctaagggaagtggcctatggagaatgggaaggactccatcccgacgaagtttac
caaagggaccacgacctttatatgcaatggctcaccgatccagcttggaactctcccccc
ggtggagaaaggggcattgacatcgcccgccggggcactagggtgctagaggaaattgaa
gaccgcttcgatgatggcaatgtgttgttggtttctcacaaagccaccatccgcatccta
ctctgctgcctcctgggcatcgacgtaggtcgttaccgagaccgttttgccatgcccgtc
accggactgagcgtggtggaattatcttcccggggaccgctctttcactgtattgcggaa
cggtctcacctcagcccctatttacgtagtttgcccagcacctag

DBGET integrated database retrieval system