KEGG   Synechocystis sp. PCC 6803: slr1751
Entry
slr1751           CDS       T00004                                 

Gene name
prc
Definition
(GenBank) carboxyl-terminal protease
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:syn01002]
    slr1751 (prc)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     slr1751 (prc)
Peptidases and inhibitors [BR:syn01002]
 Serine peptidases
  Family S41: C-terminal processing peptidase family
   slr1751 (prc)
SSDB
Motif
Pfam: Peptidase_S41 PDZ_6 PDZ_2 PDZ Tricorn_C1 OmpH
Other DBs
NCBI-ProteinID: BAA17498
CyanoBase: slr1751
CYORF: slr1751
UniProt: P73458
Position
1015511..1016782
AA seq 423 aa
MLKQKRSLILGTTALLLTTVAVTGVGLRLARSQGYLQDNPKELVDEVWQIVNRTYVDGTF
NGEDWVAVRQDYLTRDYKNQEEAYTAIREMLEKLNDPYTRFMSPDEFQSMRIDTSGELTG
VGIQITQDQDTKKIVVVAPIEDTPAYNAGILSKDVITKIDGKSTDGMEVDDAVKLIRGKP
GTSVVLTIEREGQAIEYPLTRTLIEIHPVRAQVEDINGARVGYIRLNQFSAQASEEMRQA
VQKLEKENVVGYIFDLRSNPGGLLYSSVDIARIWLDEGGIVSTVDRRGEVEQQSANKRQL
SNRPLVVLVDGGSASASEIVSGALQDNQRAVIVGTKTFGKGLVQSVRELGDGSGMAVTIA
KYLTPNGRDINKHGIDPDVEVELTDAQRKELQQNREKVGTLEDPQFARAYEVLMQQVNKT
ASK
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgttgaaacaaaaacgcagtctgattttgggaactacagctctgttattgacaacagtg
gcggtgacgggggttgggttgcgattggcccgctcccagggctacctacaggataatccc
aaggagctggttgacgaagtttggcagattgtcaaccgcacctatgtagatggtactttc
aacggtgaggattgggtagcggttcgccaggattatctaacacgggactacaaaaaccag
gaagaagcctacaccgccattcgggaaatgctggagaagctaaatgacccctacactcgc
ttcatgtcccccgatgagtttcaatcaatgcgtatcgacacttccggtgaattgaccggg
gtgggtattcaaatcacccaggaccaggatacgaagaaaattgtggtggtggctcccatc
gaagatacccccgcctacaacgctggcattctttctaaggacgtaattaccaagattgac
ggtaagtccaccgatggcatggaagtagatgacgcagtgaagttaattcggggtaagccc
ggcaccagtgtggtgctcactattgagcgggaagggcaggcgatcgaatatcctttgacc
cggactttaattgaaattcatccagtgcgggcccaagtggaagatattaatggtgccagg
gttggttatatccgtttaaatcaattcagtgcccaggcttcggaggaaatgcgccaagca
gtgcagaaattggaaaaagagaatgtggtgggctacattttcgacctgcgttccaatccc
ggtggtttgctttattccagtgtggatattgctcgcatttggttggatgaagggggcatt
gtgtccaccgtcgatcgccgaggggaagtggaacaacaaagtgctaacaagcggcagttg
agtaaccgtcccctagtggtgttggtggatggtggttccgccagtgccagtgaaatcgtc
tccggggccttacaggataatcaacgggccgtcattgtgggcaccaaaacctttggtaag
ggattagtacaatcggtgcgggaattgggggatggttccggtatggcagtgacgatcgcc
aaatatttaacccccaacggtcgggacatcaataaacatggcatcgaccccgatgtggaa
gtagaactcaccgacgcccagcggaaggaattgcaacaaaatcgggaaaaagtaggcacc
ctggaagacccccaatttgccagggcctatgaagtgctaatgcaacaggtgaacaaaacc
gcttctaagtag

DBGET integrated database retrieval system