KEGG   Synechocystis sp. PCC 6803: slr1752
Entry
slr1752           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Uma2
Other DBs
NCBI-ProteinID: BAA17499
CyanoBase: slr1752
CYORF: slr1752
UniProt: P73459
Position
1016830..1017495
AA seq 221 aa
MVQTALLPLDFPDLYPESDGKPMADNTLQYHWIVRLVTNLKHLFQGKTVFVAGDLLWYPE
QVASPPAPCQAPDAMVVLGRPDGERHSYKQWEEDHIAPQVVFEILSESNSAREMLHKQTF
YRRYGVLEMFFYDPESYDFWGQARSHPDAEFKTITLLNFPWTSPTLGIRFEMFADGLKLF
FPNGEPFKDPETLFEERDQAQQERDRAFAKLRELGIDPSTL
NT seq 666 nt   +upstreamnt  +downstreamnt
atggttcaaactgccctacttcccctcgactttcccgatctatatccggaatccgacggt
aaacccatggctgacaataccctgcagtatcactggattgtccgtttggtgaccaatctt
aagcatttatttcagggcaaaacagtctttgtagcgggggatttactttggtatcccgaa
caagtggccagtccccccgcaccctgccaggcacccgatgccatggtggttctgggaaga
cctgatggggaacgacacagttacaaacaatgggaagaagaccatattgctccccaggta
gtatttgaaattctttccgagagtaacagtgccagggaaatgctccataagcaaacgttt
tatcggcggtatggagtattagagatgttcttttacgatccagagtcctatgacttttgg
ggtcaggcgcgttcccacccagatgcagaatttaaaaccatcaccctgctcaattttccc
tggacttctccaaccctaggaattcgctttgaaatgtttgccgatggcttgaaactgttt
ttccccaacggagagccatttaaagatccagaaaccctttttgaagaaagggatcaggct
caacaggaaagagaccgagcttttgctaaattgcgggaattgggtattgacccttctacc
ctgtaa

DBGET integrated database retrieval system