KEGG   Synechocystis sp. PCC 6803: slr1776
Entry
slr1776           CDS       T00004                                 

Name
(GenBank) high affinity sulfate transporter
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Sulfate_transp STAS MFS_MOT1
Other DBs
NCBI-ProteinID: BAA16785
CyanoBase: slr1776
CYORF: slr1776
UniProt: P72770
Position
228866..230566
AA seq 566 aa
MIKQIFPIFQWLPNYHPSWLKADVVAGLTLAAYAIPVALAYGSLAGLPSEVGLYCYMLGA
VGYAFFGTSRQLALGPTSAISILVGVSLAPLANDDAGRYLILASSTAILVAIICLLAWLL
KLSQIVNFISEPILTGFKAGAALQIASTQLPKLFGVPSGGSNFFSRIWDLFHHWQEIQPA
TLLVGGLALVLLVMGDRLWPSKPISLMVVILAIVVMGITNLLEQGVKVVGEIPQGLPSFG
MPHWSFSDLDSLLPLALACFLLSYIEGISTARSFAIKHHYRINPEQELLAIGAANLAAGL
GQGYPIAGGLSQSAVNEKAGAKTPLAIIITACIIAIVLLFFTGLFSNLPEAILGSVVLVA
VKGLINIPELQHLKKIAPLEFKVSLIALFGVLCFGVLQGVLLAAIASILFLIHIISYPSS
AVLGRIPGSDQFSDLERHPENLVISGVLIYRINGPILYFNINNIESDLFNHLAQQQEPVE
LVIFEMGTSPGIDTPAARWFKTLSQSLNQQGITLKLVNASGFVRDRLRAEGLEGEVGTFR
RLDTVDSLISEFNCQRYSDLPHTEND
NT seq 1701 nt   +upstreamnt  +downstreamnt
gtgattaaacaaatatttcccattttccagtggttaccaaattatcatcctagttggctg
aaagctgatgtggtggcgggtttaacccttgcggcctatgccattcccgtggccctagcc
tatggatctttagcgggattgccctctgaggtgggattgtattgttatatgttgggggcc
gttggctacgcttttttcggtacttcccgtcaattagcgttgggacccacgtctgctatt
tccattcttgtcggggtgagtttagcccccctggctaacgacgatgctgggcgttatttg
attttggcatcttccactgcgattttggtagcaataatttgcctgctagcttggttactc
aagttatcccagattgttaattttatttccgaaccaatcttgaccggttttaaagcgggg
gcggcattacaaattgcatctacccaattacccaaattatttggtgtgccgtctggggga
agtaacttttttagtcgtatttgggatttattccaccattggcaggaaattcagcctgca
actttactggtgggaggtttggctctggttttgctcgttatgggcgatcgcctttggcca
tccaaacctatttccctgatggtagtgattttggccattgttgttatgggaatcacaaat
ttactcgaacagggggtgaaagtggtgggggaaattccccagggtttacctagttttggg
atgccccattggagttttagtgaccttgatagcctattgcccctcgccctagcttgtttt
ttactgtcctatatcgaaggtatttccaccgcccgtagttttgccatcaaacatcactat
cgcattaatccagaacaggaattgttggcgatcggggcggctaatctggcggcgggttta
gggcaaggttatcccattgccgggggactttctcaatcggcagtaaatgaaaaagcaggg
gcaaaaacacccttagcaatcattattactgcctgtattattgccatagtcttgctgttt
tttaccggtcttttcagcaatttaccagaggcaatcctgggatcggtagttttagtggcg
gtaaaagggttaattaatattcctgagttacaacatctcaaaaaaattgcccctctggaa
tttaaggtttcccttattgctctgttcggggtactttgctttggggtgctacagggggtt
ttattagcggcgatcgcctccattttgttcttgatccatattatttcttatcctagtagc
gcagttttaggaagaattcctggctctgaccaatttagcgaccttgaacgtcatccggaa
aatttagtcatttctggggtattgatttatcgaatcaatggaccaattttatatttcaat
attaataacatcgaaagtgatttatttaaccaccttgctcaacagcaagagccagtagag
ttagtgatttttgaaatgggaacctcccctggtattgatactcctgctgctcgttggttt
aaaaccttatcgcaaagccttaatcaacagggcataactttaaaattagtaaatgctagc
gggttcgtgcgggatcgtttgcgggcagaagggttagaaggtgaagtaggaactttccga
cgtttagacaccgttgattccctgatttctgagtttaattgccaacgatattcagattta
ccccataccgaaaatgactga

DBGET integrated database retrieval system