KEGG   Synechocystis sp. PCC 6803: slr1819Help
Entry
slr1819           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pentapeptide Pentapeptide_4 Pentapeptide_3 CtsR_C
Motif
Other DBs
NCBI-ProteinID: BAA17756
CyanoBase: slr1819
CYORF: slr1819
UniProt: P73709
Position
1300661..1301656
Genome map
AA seq 331 aa AA seqDB search
MEAKELVQRYRNGETLFTGLKLPGINLEAADLIGIVLNEADLRGANLLFCYLNRANLGQA
NLVAANLSGASLNQADLAGADLRSANFHGAMLQGAILRDSDMTLATLQDTNLIGADLRGA
DLSGATLTGACLRGANMRQEKKGYYTNLQAAILGRADLQGANMKGVDLSRADLSYANLKE
ANLRDVDLRKADLSYANLKGALLTDANLSGAKLNGADLQNANLMRAKISEAEMTAVNCQG
AIMTHVNLNRTNLTGSNLSFTRMNSADLSRANLTKANLQEAELIEAFFARANLTEANFIN
ANLVRADLMSANMVGADFQGATMPDGQVRHH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggaattggtccaacgctatcgcaacggcgaaactttatttacagggcta
aaattaccggggattaatctagaagccgccgatttgatcggtattgtgctcaatgaagcg
gatttacggggggctaacctgcttttttgttacctcaaccgggctaatctaggtcaggct
aatttggtggcggcgaacctaagtggggctagtttaaaccaggcagacctggccggagcc
gatctacgcagtgccaattttcacggggccatgctccagggggctatcctgcgggatagc
gacatgaccctggccactctccaggatacgaatttaattggggcggatctacggggagcg
gatttaagtggtgctaccctcaccggggcctgtttgcggggagctaatatgcgtcaggaa
aaaaagggctactacaccaatctccaggccgctatcctcggtcgggcagacctccagggg
gccaacatgaagggggtagatttaagccgggcagatttaagctacgctaacttgaaggag
gctaatctgcgagatgtggatttgcgtaaggcagacctgagctacgccaacttaaaaggg
gccctgctaactgacgctaacttgtcgggggcaaagttaaatggtgccgatttacaaaat
gccaatttgatgcgagcgaagatttctgaggcagaaatgacggcagtgaattgccagggg
gccattatgacccatgtcaacctgaatcggaccaatctcacggggtccaatttgagcttc
acccgcatgaacagtgccgacctgagtcgggccaacttgactaaagctaacctacaggaa
gcagagctgattgaagcattttttgccagggccaatttgacggaggccaacttcatcaat
gccaacttggtgcgggcggatctaatgagtgccaatatggtgggggcagattttcaaggg
gcgactatgccggatgggcaagtgcgtcaccactag

DBGET integrated database retrieval system