KEGG   Synechocystis sp. PCC 6803: slr1838Help
Entry
slr1838           CDS       T00004                                 

Gene name
ccmK
Definition
(GenBank) carbon dioxide concentrating mechanism protein; CcmK
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BMC HPTransfase
Motif
Other DBs
NCBI-ProteinID: BAA17446
CyanoBase: slr1838
CYORF: slr1838
UniProt: P73406
Position
955805..956116
Genome map
AA seq 103 aa AA seqDB search
MPQAVGVIQTLGFPSVLAAADAMLKGGRVTLVYYDLAERGNFVVAIRGPVSEVNLSMKMG
LAAVNESVMGGEIVSHYIVPNPPENVLAVLPVEYTEKVARFRT
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggccgttggcgtgatacagacccttggctttccctccgttttggccgctgcc
gatgccatgctcaagggcggtagggtgaccctggtgtactatgacttggccgagaggggg
aattttgtggtggcgatacggggcccagtatcagaggtgaatctgtcaatgaagatgggt
ctagcggcggtcaatgagtctgttatggggggagaaattgtcagccactatattgtgccc
aatccacccgaaaatgtactggcagttttgccggtggaatacacagaaaaagtcgctcgc
ttccgcacctga

DBGET integrated database retrieval system