KEGG   Synechocystis sp. PCC 6803: slr1839Help
Entry
slr1839           CDS       T00004                                 

Gene name
ccmK
Definition
(GenBank) carbon dioxide concentrating mechanism protein; CcmK
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BMC HPTransfase
Motif
Other DBs
NCBI-ProteinID: BAA17447
CyanoBase: slr1839
CYORF: slr1839
UniProt: P73407
Structure
PDB: 

Position
956275..956613
Genome map
AA seq 112 aa AA seqDB search
MSAQSAVGSIETIGFPGILAAADAMVKAGRITIVGYIRAGSARFTLNIRGDVQEVKTAMA
AGIDAINRTEGADVKTWVIIPRPHENVVAVLPIDFSPEVEPFREAAEGLNRR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccaatccgccgtcggttccattgaaaccattggttttcccggtattcttgcc
gctgctgatgccatggttaaggccggtaggattaccattgtgggctatattcgggcgggg
agtgctcgcttcacccttaatattcgtggggatgtgcaggaagtgaaaactgccatggct
gctggtattgatgccattaaccgaactgaaggggcagacgtgaaaacctgggtgattatt
ccccgaccccatgaaaacgtagtggcagttctgcccatcgattttagtcctgaagtggag
cctttccgggaagcagcagaaggtttaaatcgtcgttaa

DBGET integrated database retrieval system