KEGG   Synechocystis sp. PCC 6803: slr1841
Entry
slr1841           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: OprB SLH DUF4148 BMFP Spectrin CLZ DUF3782
Other DBs
NCBI-ProteinID: BAA17449
CyanoBase: slr1841
CYORF: slr1841
UniProt: P73409
Position
958137..960029
AA seq 630 aa
MLKLSWKSLLVSPAVIGAALVAGAASAAPDNVTNAQVLDQLDQYTAEGQSSAIDQVTSVS
ELRDVQPTAWAYEALKSLVERYGCIVGYPDRTFRGDRALSRWEFAAGLNACMNVMERLIQ
ENVAVLREDIDKLKRLMQEFEAELAALGARVDNLEARTSFLEDHQFSTTTKLTGEVIFAP
TAIFGTKKTLNNQTDNNQAVFQNRVRLQFNTSFSGEDLLVTRLAAGNGNRFKSFYPTQNV
IDPETGNPIGIVGDYYESPTFTQVHQLSPGDNNNVAVDWLAYYVPLDLGENFRLNNYIAA
WGGIWDDFVPTLNPYFDDYTGGKGSLSQFTAQNPIYSIGGGTGIGTSLELGFLSNLLGPT
SLSLGYLASTGNNPSSGGSVTNPATGNNYDFSSGGNGLFNGGYSALAQITTNIFDRVSLG
FTYVNAYTTPDAAIFGKGGTQGIVGTTAANLNRSELNDDFVNGLGVGAPPVDAATYNNNV
SGGSTSGNVINPYDFGGKQTNSYGVQMAWNIADWLSFSAYGSYTNVTLIGKDNGDIWTYG
GGFAFPDLGKEGNVLGIFAGVQPYVSGFTNNTLGTTFVTTANPLQVELFYKYQLTDNLSI
TPGVIWISKPEQTTNATDAFIGTVRGTFTF
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcttaaactatcttggaagtccctgttagtgagccctgctgtgatcggtgccgccctt
gtggctggtgctgctagtgctgctcccgacaacgttacgaatgctcaagttttagaccaa
ttagaccaatacactgccgaaggtcagtcttctgccattgatcaagtaaccagcgttagc
gaactccgcgatgtgcaacccactgcctgggcctatgaagcgctcaagagcttggtggaa
cgctacggttgtatcgttggttaccctgaccgtaccttccgtggtgatcgagccctcagc
cgttgggaatttgccgctggtcttaacgcctgtatgaacgttatggaacgtttgattcag
gaaaacgtggctgttctccgggaggacatcgacaaactgaaacgcctcatgcaggaattc
gaggcagaattggctgctttgggtgctcgggttgataacctcgaagcccgcacctctttc
ctcgaagaccatcagttttctaccaccaccaaattgaccggggaagtaatatttgctccc
accgccatttttggtaccaaaaagactctcaacaaccaaaccgataacaaccaagcggta
ttccagaaccgggttcgtttacagttcaacaccagcttctccggtgaagacctgttggtc
actcgtctcgccgctggtaacggtaatcgcttcaagagcttctatcctactcagaatgtt
attgatcccgagaccggtaaccccatcggtattgtaggtgactactatgaaagccccacc
tttacccaggtgcaccagctttcccccggcgacaacaacaacgtagccgttgactggtta
gcttactatgttcccttggatctgggcgaaaacttccgtctcaacaactacattgctgct
tggggcggtatctgggatgacttcgttcctaccctgaacccctatttcgacgactacact
ggcggcaaaggttccttgagtcagttcaccgcccagaaccccatctactccattggtggc
ggtactggtataggtacaagcctagagttgggcttcctcagcaatctgttgggccccact
tccttgagcttgggttacttggctagcacgggcaacaaccccagcagtggtggttctgtt
actaaccctgccactggcaacaattatgacttcagcagcggtggtaacggtttgtttaac
ggtggctatagcgccttggctcaaattaccaccaacattttcgaccgggttagcctaggc
ttcacctacgttaatgcctacaccacccctgatgccgctatcttcggtaaaggtggcact
caaggtatcgtcggtaccactgcggctaacctcaaccgttctgagttgaatgatgacttt
gtgaacggtttgggtgtaggtgctcctcctgtggatgcagctacctacaacaataatgtg
agcggcggtagcacatctggcaacgttatcaacccctatgactttggtggcaagcaaacc
aacagctatggcgtccaaatggcttggaacattgccgattggctgagcttcagtgcctat
ggtagctacaccaatgttactttgattggtaaagacaatggtgatatctggacctacggt
ggaggctttgccttccccgaccttggtaaagaaggtaacgttcttggcatctttgctggt
gttcaaccctatgtttccggtttcaccaacaatactttgggaaccacctttgtaaccact
gctaaccctctgcaagttgaattgttctacaaatatcaactcaccgacaacctttctata
actcctggtgtgatctggatctccaagcctgaacagaccaccaacgccaccgacgccttc
atcggcaccgtccgtggtaccttcactttctaa

DBGET integrated database retrieval system