KEGG   Synechocystis sp. PCC 6803: slr1843Help
Entry
slr1843           CDS       T00004                                 

Gene name
zwf
Definition
(GenBank) glucose 6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00030  Pentose phosphate pathway
syn00480  Glutathione metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
syn01130  Biosynthesis of antibiotics
syn01200  Carbon metabolism
Module
syn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
syn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    slr1843 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    slr1843 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syn04147]
    slr1843 (zwf)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     slr1843 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     slr1843 (zwf)
Exosome [BR:syn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   slr1843 (zwf)
  Exosomal proteins of colorectal cancer cells
   slr1843 (zwf)
  Exosomal proteins of bladder cancer cells
   slr1843 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAA17451
CyanoBase: slr1843
CYORF: slr1843
UniProt: P73411
Position
961201..962730
Genome map
AA seq 509 aa AA seqDB search
MVTLLENPFRTGLRQERTPEPLILTIFGASGDLTQRKLVPAIYQMKRERRLPPELTVVGF
ARRDWSHDHFREQMRKGIEEFSTGIGSEDLWNEFAQGLFYCSGNMDDPESYLKLKNFLGE
LDEKRNTRGNRVFYLAVSPNFFPPGIKQLGAAGMLSDPVKSRIVIEKPFGRDLSSAQSLN
RVVQSVCKENQVYRIDHYLGKETVQNLMVFRFANAIFEPLWNRQFVDHVQITVAETVGVE
ERAGYYESAGALRDMVQNHLMQLFCLTAMDPPNAIDADSIRNEKVKVLQATRLADINNLE
NAGIRGQYKAGWMGGKPVPGYREEPGVDPSSTTPTFAALKLMVDNWRWQGVPFYLRTGKR
MPKKVSEIAIQFRQVPLLIFQSVAHQANPNVLSLRIQPNEGISLRFEAKMPGSELRTRTV
DMDFSYGSSFGVAAADAYHRLLLDCMLGDQTLFTRADEVEEAWRVVTPVLSAWDAPSDPL
SMPLYEAGTWEPAEAEWLINKDGRRWRRL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgctactcgaaaatcccttccgcactggactccgtcaagaacgcactccagaa
cccctcattttgaccatttttggtgcatccggggaccttacccaacggaaattggtgcca
gccatctaccaaatgaaacgagagcgccgcttgcctccagagttaacggtggtcggtttt
gcgagaagggactggagccacgaccattttcgtgagcagatgcgtaagggcatcgaagaa
ttttccaccggcattggcagtgaagacctgtggaatgagtttgcccagggtttattctac
tgctctggcaatatggatgacccagaaagctatctcaaattgaaaaacttcctgggggaa
ttggatgaaaaacgtaacaccagaggcaatcgagtcttttatttagctgtttcccccaac
ttctttcccccgggtattaaacaattgggggcagcgggtatgctgagtgacccggttaaa
agtcgcattgtgatcgaaaagccctttggtcgggatttgagttcagcccaaagcttgaac
cgggtagtgcagagtgtctgcaaagaaaatcaggtgtatcgcatcgatcattacctgggc
aaagaaacggtgcaaaatctgatggtgttccgctttgccaacgctatttttgagccactg
tggaaccgtcagtttgttgatcatgtgcaaattaccgtagcagaaacggtaggggtagaa
gaacgagccggttattacgaatccgccggggctttacgagatatggtgcagaatcacctc
atgcaactgttttgtctcaccgccatggacccccccaatgccattgacgcggacagcatt
cgcaacgaaaaggttaaagtgttgcaggctacccgtttagcggatattaataatttggaa
aatgccggtatccggggccaatataaagctggttggatgggaggcaaaccagtgccgggt
tatcgagaagaaccgggggtagatccaagttccaccactcctacctttgcggccctcaaa
ctgatggtggataactggcgttggcagggggtgcccttctatctacgcacgggtaagcgc
atgcctaaaaaagtgagtgaaatcgcaattcaattccggcaagtacctctgttaattttt
caatcggtggcccaccaagctaatcccaatgtgttgagtctaagaattcagcccaacgaa
ggcatttccctgcgttttgaggcaaaaatgcccggttcagaactgcgtacccgcactgta
gatatggattttagttatggttcatcctttggagtggccgcagcggatgcctatcaccgc
cttttattagattgtatgttgggagaccaaaccctgttcacaagagccgacgaggtagaa
gaagcttggcgagtagtaactccggtgttgtcggcttgggatgcccccagtgatcctctt
tccatgcccttgtacgaagctggaacctgggaaccagcggaggcagaatggttaattaat
aaagatggccgtcgctggcgccgactttag

DBGET integrated database retrieval system