KEGG   Synechocystis sp. PCC 6803: slr1878
Entry
slr1878           CDS       T00004                                 

Gene name
cpcE
Definition
(GenBank) phycocyanin alpha phycocyanobilin lyase; CpcE
  KO
K02288  phycocyanobilin lyase subunit alpha [EC:4.4.1.32]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00196  Photosynthesis - antenna proteins
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    slr1878 (cpcE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syn00194]
    slr1878 (cpcE)
Enzymes [BR:syn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     slr1878 (cpcE)
Photosynthesis proteins [BR:syn00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    slr1878 (cpcE)
SSDB
Motif
Pfam: HEAT_2 HEAT_PBS HEAT_EZ HEAT Arm
Other DBs
NCBI-ProteinID: BAA17683
CyanoBase: slr1878
CYORF: slr1878
UniProt: P73638
Position
1229120..1229938
AA seq 272 aa
MSEPNLNPAYTLDQAIANLQQTEDASARYYAAWWIGRFRAAQPETIAALLVALEDETDRS
PDGGYPLRRNAAKALGKLGDRQVVPALIKALECEDYYVRESAAQALEGLGDARAMAPLMA
KLTGGLAAAQLVEGKPHLAQPYEAIIEALGTLQAVESIGLIEPFLEHFSPKVQYAAARAL
FQLTGDNRYGDLLITALGGTDLQLRRSAMMDLGATGYLPGAQAIAKAFAENSLKLIALRD
LWATHRQRQASSESKALSPASRQILELMDSLL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagtgaacctaacctcaaccccgcctataccctcgaccaggcgatcgccaatttgcaa
caaacagaagatgccagtgcccgttactatgcggcctggtggattggtcgttttcgcgct
gctcaaccggaaaccattgctgctttgttggtcgccttggaagatgaaactgatcgctcc
ccggacggtggttatcccctgcggcgtaatgcggctaaagcgttgggaaaattaggcgat
cgccaagtggtgccggccctaatcaaagccttggaatgtgaagattactatgtgcgagag
tcagcggcccaggcgctggaaggtttgggggatgctagagcgatggcacctctaatggcc
aagttaacggggggattagcagcggcccagcttgtggagggtaaaccccatttagcccaa
ccctacgaagcgattattgaagccctgggtactctccaagctgtggagtccattggttta
attgaaccgtttctagagcatttttccccgaaagtccaatacgccgccgccagggcccta
tttcagttaactggggataaccgttacggcgaccttctcattactgctctgggggggaca
gacttacaattacgccgttccgccatgatggatttgggagccactggctacttgcccggc
gcccaggcgatcgccaaagcctttgcagaaaatagcctcaagttgatcgccctgcgagat
ttgtgggccacccatcgccaaaggcaagcaagttctgaatcgaaggcgctcagtccagct
agccgacaaatattggaattaatggatagtttactctga

DBGET integrated database retrieval system