KEGG   Synechocystis sp. PCC 6803: slr1881
Entry
slr1881           CDS       T00004                                 

Symbol
livF
Name
(GenBank) high-affinity branched-chain amino acid transport ATP-binding protein; BraG
  KO
K11958  neutral amino acid transport system ATP-binding protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    slr1881 (livF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr1881 (livF)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Neutral amino acid transporter
    slr1881 (livF)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_27 Mg_chelatase AAA_16 AAA_33 AAA_22 AAA_23 AAA_15 MukB AAA_13 NACHT RsgA_GTPase AAA_25 AAA_14 NB-ARC AAA_24 AAA
Other DBs
NCBI-ProteinID: BAA17695
CyanoBase: slr1881
CYORF: slr1881
UniProt: P73650
Position
1239490..1240212
AA seq 240 aa
MSDLLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQG
EIIFKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIY
TMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIK
AINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLGAAYHN
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtctgacctcctcgttgttaaggacgtattcgctggctatgtggctgatgtgcccatt
ttgcagggtattaatttctccattgcgccgggggagttggtcacagttatcggccccaac
ggagcgggaaagtccaccctagccaaaactatttttggcctactcactccaagccagggg
gagattatttttaaaggggaaaatattaccggccttggttctgaccaaattgtgcgtcgg
ggaatgtgctatgtgccccaggtttgtaatgtgtttggcagcctaacagtggcagagaat
ttggatatgggggcctttctacaccagggtcctacccaaaccctaaaggaccgcatctat
accatgtttcccaaattagcccaacgccgcaaccagagggctgggactttatcgggggga
gaacggcaaatgttggccatgggtcgggctttgatgttagacccggatttgttgttgcta
gatgaaccgtcggcggccctatcccccattttggtcaaggatgtgttcgcccaaattaag
gccattaatgcaactggtaaggcaattattctagtggagcaaaatgccaaacaggccttg
atgatggctgatcggggttacgtgctagaaaatggccgggataagttggaaggatcgggg
caaagtctactcaatgatcctttggtgggagaactttatttgggggcagcgtatcacaac
taa

DBGET integrated database retrieval system