KEGG   Synechocystis sp. PCC 6803: slr2123Help
Entry
slr2123           CDS       T00004                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase family
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN F420_oxidored AdoHcyase_NAD NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAA18060
CyanoBase: slr2123
CYORF: slr2123
UniProt: P73990
Position
1635746..1636702
Genome map
AA seq 318 aa AA seqDB search
MKWKVLVTCPPMLHTLEHCQTRFEQEQLDVVAPTITQQLSEAELCEQIADFDGVIAGDDP
FTARVLTIGKQGKLKALAKWGIGVDAIDLAAAKQLGILTSNTPNVFGDEVADVAIGYLIL
LARELHCIDQAVRQGEWLKIRGHSLRGKTAGIIGVGSIGQAIAVRLQSMGLKLLGYDPHP
ISADFCEQTGLHPVPLQDVLQQADCLFLACNLTPDNFHLLNADTFDQMKPGVWLINVARG
GLVDQAALIETLQTGKVAKAALDVFEQEPLAADSPLTQLPQVILGSHNGSNTREAVLKVN
QLAIDNLVRDLQRATSGD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaaagttttagtaacctgtccccccatgctccataccctagagcattgtcaa
acccgattcgagcaagaacagttagacgtggttgccccaaccattacccaacagttatcc
gaagctgaactctgtgaacaaattgccgattttgatggggtaatcgccggggatgatccc
tttaccgcaagagtgttaactatcggcaaacaaggcaaactaaaagcactggccaaatgg
ggcattggcgttgatgctatcgatttagccgccgcaaaacagttgggaattttgacatcc
aatacccccaatgtctttggtgatgaagtggccgacgtggcgatcggttacctaattctc
ttggcaagggaattgcactgcattgatcaagccgttcggcaaggggaatggttgaagatt
cgcggccactccctccggggtaaaacagccggcattatcggggtaggcagtattggtcag
gcgatcgccgttcgtttacaaagtatggggctgaaattgttaggctatgacccacatccc
attagcgccgacttctgtgagcaaactggattgcatcctgtaccgctgcaagatgtatta
caacaggcggattgtttgtttttagcctgtaatcttaccccagataactttcacctcctg
aatgcagatacctttgaccagatgaaacccggcgtttggctcattaacgttgccagggga
ggattagtggatcaagcagcactcatagaaacattgcaaactggaaaagtcgctaaggca
gccctagacgtgtttgagcaagaacccttggcggccgacagtcccttaacccaactgccc
caggtaattctgggatctcataatggttctaatacccgagaggcagttctcaaggtgaat
cagttggccattgataatttggtgcgggacttacaacgagcaacatcgggagactaa

DBGET integrated database retrieval system