KEGG   Synechocystis sp. PCC 6803: slr2135
Entry
slr2135           CDS       T00004                                 

Gene name
hupE
Definition
(GenBank) hydrogenase accessory protein
  KO
K03192  urease accessory protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    slr2135 (hupE)
SSDB
Motif
Pfam: HupE_UreJ HupE_UreJ_2
Other DBs
NCBI-ProteinID: BAA17716
CyanoBase: slr2135
CYORF: slr2135
UniProt: P73671
Position
1261217..1261993
AA seq 258 aa
MLGLGTKFSWFHWVTASGGNGEKLVQSQYCPATVMGPGPKSGCPPTMADSVNQICEVQVV
NVTGLSNLLTFPRLLAHHPFGGHTPSNFLEGFLSGLGHPVIGLDHLAFVIAIGLIAAGLR
YGWLMPLIFVATAITGTGLHLIGANLPQPELVIAGSVLLFGIFLALGRPLPSPLVMGLAA
VAGMFHGYAYGEAIVGAQMNPVAAYLLGFSFIQLAIAMGVYALAKGWYETKETLLNLRFI
GFLLTGVGLAFTSGALLG
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctagggttggggactaagtttagttggttccattgggtaacagccagtggaggtaac
ggggaaaagctggtgcaaagccaatactgtcccgcaactgtgatgggcccaggccctaag
tcaggatgcccgccaacgatggccgattccgttaatcaaatctgcgaggtacaggttgtg
aatgttacaggtttatctaatttactgactttcccccggctcctagcccaccatcccttt
gggggccatacccccagtaatttcctggaaggtttcctctccggcctggggcaccccgtc
attggcctagaccaccttgcttttgtcattgccattggcctgattgccgctgggttacgc
tacggttggctaatgcccctcatttttgtcgccacggcgatcaccggcacagggttgcat
ttaattggggctaatctgccccagccagaattggtcatcgccggttccgtacttttattc
ggcatcttccttgctttgggtcgtcctctgccatctcccctagtaatgggattagccgct
gtggccggtatgttccatggctacgcctatggagaagccattgtcggggcgcaaatgaat
cccgttgccgcctatttgctcggtttttccttcattcaactagcgatcgccatgggagtc
tatgccttagccaagggctggtacgaaaccaaagaaaccttgctcaatctaagatttatt
ggctttctgctaacaggagtaggactagccttcacctccggcgccttgttggggtaa

DBGET integrated database retrieval system