KEGG   Synechocystis sp. PCC 6803: ssl1045
Entry
ssl1045           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: CYTH LisH_2
Other DBs
NCBI-ProteinID: BAA10495
CyanoBase: ssl1045
CYORF: ssl1045
UniProt: P74774
Position
complement(2817226..2817453)
AA seq 75 aa
MAIEIEHKFLVKDDRWRSLVQGYLYRQGYIATPDLTTLRVRTIGDRAYLTIKGKNASIAR
LDLSMKFLQWKPIKF
NT seq 228 nt   +upstreamnt  +downstreamnt
gtggccatcgagattgaacataaattcctggttaaagatgaccgctggcggagtttagtc
cagggttatttgtaccgtcaaggttacattgccaccccagatttaactacgctgcgagtc
cgtaccattggcgatcgggcctatctcaccattaagggtaaaaatgccagcattgcccgc
ttggatttgagtatgaaattcttgcagtggaagccaattaaattttga

DBGET integrated database retrieval system