KEGG   Synechocystis sp. PCC 6803: ssl1552Help
Entry
ssl1552           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2613 BRCA2 SNARE
Motif
Other DBs
NCBI-ProteinID: BAA10519
CyanoBase: ssl1552
CYORF: ssl1552
UniProt: P74776
Position
complement(2844809..2845072)
Genome map
AA seq 87 aa AA seqDB search
MVFPSPNGGGSDQGNSNFDEYDDITGARREEALKKARNWFVILVVGGLVLGVVVAFGVVQ
VLNSLGLTEKPDAPLRIEMERENPPQQ
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggttttcccttcccccaatggtggtggctccgatcaaggtaactctaattttgacgaa
tacgacgacatcacgggagctcgtcgggaagaggctctgaaaaaagcccgcaactggttt
gtcattttggtggtgggaggactggtgctgggggtagtggtggcctttggcgtggtgcag
gttctcaatagcttgggattaacggaaaaacctgatgctcccctccgcattgagatggag
cgggaaaatccaccccagcaatag

DBGET integrated database retrieval system