KEGG   Synechocystis sp. PCC 6803: ssl2250
Entry
ssl2250           CDS       T00004                                 

Definition
(GenBank) glycoprotein 64
  KO
K02192  bacterioferritin-associated ferredoxin
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ssl2250
SSDB
Motif
Pfam: Fer2_BFD NADH_4Fe-4S DUF4258
Other DBs
NCBI-ProteinID: BAA17524
CyanoBase: ssl2250
CYORF: ssl2250
UniProt: P73484
Position
complement(1044517..1044693)
AA seq 58 aa
MYICVCRGISDKQIEAAAQQGITSLEELSESMGVGADCGVCQGHACQVLEAIARRKLT
NT seq 177 nt   +upstreamnt  +downstreamnt
atgtatatctgcgtttgccggggtattagcgataagcaaattgaagcggctgcccagcag
ggcataacctccctagaagagttgtccgagtccatgggagtaggggctgactgcggtgtc
tgccaaggccatgcttgccaggtgctagaggcgatcgccagaaggaaattaacctag

DBGET integrated database retrieval system