KEGG   Synechocystis sp. PCC 6803: ssl3177
Entry
ssl3177           CDS       T00004                                 

Gene name
repA
Definition
(GenBank) rare lipoprotein A
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DPBB_1 Barwin
Other DBs
NCBI-ProteinID: BAA17495
CyanoBase: ssl3177
CYORF: ssl3177
UniProt: P73455
Position
complement(1012616..1012888)
AA seq 90 aa
MMAQSATFYGNQFVGRKMANGQVYNHGRMVAAHPSLPLGTRVRVTNRRTGKSVVVTVSDR
CNCSIDLSRSAFQQIANPRKGRVPVSITRL
NT seq 273 nt   +upstreamnt  +downstreamnt
gtgatggcccaatccgccactttctatggcaatcagtttgtagggcggaagatggccaac
ggccaagtctataaccacggtcgcatggtggcagcccaccccagtctgcccctaggaacc
agagttagggtaaccaatcgccgtacggggaaatcggtcgtagtgacggtgagtgaccgt
tgtaactgctccatcgacctcagccgttctgctttccaacaaattgctaacccccgcaaa
ggccgggttcccgtaagcattacccgtctctag

DBGET integrated database retrieval system