KEGG   Synechocystis sp. PCC 6803: ssr1038
Entry
ssr1038           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA10614
CyanoBase: ssr1038
CYORF: ssr1038
UniProt: P74800
Position
2950107..2950343
AA seq 78 aa
MNTTSPIDWDEMFEYLPGTIVELKSEPGVLYQIDCYETSMVPPIWLVGNPRPRYPHQMRI
VSRQQVKACELELEPSLA
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaataccacatctcccattgactgggatgaaatgtttgagtatttgccggggacaata
gtagaactcaaatccgaaccgggggttttatatcaaattgactgttacgaaaccagtatg
gtgccccccatttggttagtgggaaatccccggccacgctatcctcatcaaatgcggatt
gtgtcacgccagcaggttaaagcttgtgaattggagcttgaaccatcccttgcctag

DBGET integrated database retrieval system