KEGG   Synechocystis sp. PCC 6803: ssr1407Help
Entry
ssr1407           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAA10515
CyanoBase: ssr1407
CYORF: ssr1407
UniProt: P74775
Position
2839689..2839904
Genome map
AA seq 71 aa AA seqDB search
MQQLAGVTATLLTPTFTQFDYFNSQVGGLELTLQDDFSPGDRQIIEEILAFYAKRYGTPE
RRPAMVSSYTA
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacagcttgccggtgtgaccgcgacccttctgactcccacttttacccagtttgac
tatttcaacagtcaggtggggggcctggagctgaccctacaggatgatttttcccccggc
gatcgccaaattattgaggaaattctcgccttctatgccaaaagatacggcactcccgag
cgacggcccgccatggtttcttcctacaccgcttag

DBGET integrated database retrieval system