KEGG   Synechocystis sp. PCC 6803: ssr1425
Entry
ssr1425           CDS       T00004                                 

Gene name
ycf34
Definition
(GenBank) ycf34 gene product
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Ycf34
Other DBs
NCBI-ProteinID: BAA10529
CyanoBase: ssr1425
CYORF: ssr1425
UniProt: P74777
Position
2857507..2857755
AA seq 82 aa
MCICVNCHYVDRCITYHAVEHQHQQPHLSDRPDFDPVNPSINVNIRTPDHGIEMEWDVVG
CDSFLQEMGKWSRLRPNELVPT
NT seq 249 nt   +upstreamnt  +downstreamnt
atgtgtatttgtgtgaactgccattacgtggaccgctgtatcacctaccatgcagtggaa
catcaacatcaacaaccccatttgagcgatcgcccggattttgatccggtcaacccttct
atcaacgtaaatattcgtacccccgaccatggcatcgaaatggaatgggatgtggtgggt
tgcgacagttttttacaagaaatgggcaaatggagccgtttacgccccaatgaattagtc
cccacctag

DBGET integrated database retrieval system