KEGG   Synechocystis sp. PCC 6803: ssr2049
Entry
ssr2049           CDS       T00004                                 

Gene name
bchB
Definition
(GenBank) protochlorophillide reductase 57 kD subunit
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: PCP_red
Other DBs
NCBI-ProteinID: BAA17520
CyanoBase: ssr2049
CYORF: ssr2049
UniProt: P73480
Position
1042306..1042557
AA seq 83 aa
MLWHVFYGRGRMLLSNHAQGRNFRPIFVMSDPISWTAEATERLKEIPFFVRPAARKKIEN
FAREAGITEITETVYEQAKQKFN
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctttggcacgtattttacggtcgcggtagaatgcttttgtcaaatcatgcccaaggg
cgaaatttcagacccatttttgtaatgagtgatcctattagttggactgccgaagcaacg
gagcgtttaaaggaaattccttttttcgttcgtcctgccgcccgtaaaaaaatcgaaaat
tttgccagggaagcaggaatcacagagataacggaaacggtctacgagcaagctaaacaa
aagttcaattag

DBGET integrated database retrieval system