KEGG   Synechocystis sp. PCC 6803: ssr2062
Entry
ssr2062           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA17534
CyanoBase: ssr2062
CYORF: ssr2062
UniProt: P73494
Position
1052518..1052784
AA seq 88 aa
MKTANFITSSCRYCRYYQAEGRRGGTCSQLNVPVQGQWKACALAAKPFAGPWENLEDVVY
LEHAYALTSKDALVEQSAETIATAAEAA
NT seq 267 nt   +upstreamnt  +downstreamnt
atgaaaaccgctaactttatcacctcatcttgtcgttattgccgctactaccaggctgaa
ggtaggcgaggcggcacttgcagtcaactcaatgtgccagtacagggacagtggaaggcc
tgtgccctagcggcaaaaccctttgccggtccctgggagaacctcgaagatgtggtgtat
ttagaacatgcctatgctttgaccagtaaggatgctctagtggaacaatcggcagaaacg
atcgccaccgcagccgaagcggcctag

DBGET integrated database retrieval system