KEGG   Synechocystis sp. PCC 6803: ssr2406
Entry
ssr2406           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF4956
Other DBs
NCBI-ProteinID: BAA17546
CyanoBase: ssr2406
CYORF: ssr2406
UniProt: P73506
Position
1065398..1065622
AA seq 74 aa
MNEPKQTETVQVVEKVSAILSPYFIVIVGLFLADSNFLIGIALVFVGVFSLLKLSWHDVQ
TGVEKVKGFFAEKQ
NT seq 225 nt   +upstreamnt  +downstreamnt
atgaatgaaccaaaacagaccgaaaccgtccaggtggtggaaaaagttagcgcgatcctt
tccccctatttcatcgtcattgtgggtttgtttttggccgatagcaattttctcattggc
attgccctggtgtttgtgggggtattttccctgctgaaactttcctggcacgatgtgcaa
acgggggtagaaaaagttaagggcttctttgccgaaaagcagtga

DBGET integrated database retrieval system