KEGG   Synechocystis sp. PCC 6803: ssr2611
Entry
ssr2611           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA17482
CyanoBase: ssr2611
CYORF: ssr2611
UniProt: P73442
Position
995022..995219
AA seq 65 aa
MTPKSGILLLLSCVSAIAAVGCVFELSSGQPELGSTTTTAILLGSIPLTALFFWIAVQDT
RANMK
NT seq 198 nt   +upstreamnt  +downstreamnt
gtgacccctaaaagtggtattcttctgctcctttcctgtgtgtcggcgatcgccgccgtg
ggctgcgtatttgaactgtcatcggggcaaccggaattgggcagtacgaccaccacggcc
attttgttgggcagtattcccctgacagcccttttcttttggattgcggtgcaggatacc
agggccaacatgaagtag

DBGET integrated database retrieval system