KEGG   Synechocystis sp. PCC 6803: ssr3184
Entry
ssr3184           CDS       T00004                                 

Definition
(GenBank) ferredoxin
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Fer4_10 Fer4_21 Fer4_7 Fer4_2 Fer4_9 Fer4 Fer4_16 Fer4_15 Fer4_6 Fer4_17 Fer4_8 Fer4_13 Fer4_3 Fer4_18 Fer4_4 Fer4_22
Other DBs
NCBI-ProteinID: BAA17694
CyanoBase: ssr3184
CYORF: ssr3184
UniProt: P73649
Position
1239156..1239383
AA seq 75 aa
MPHTIVTETCEGVADCVEACPVACIHPGDGKNTIGTDWYWIDFATCIDCGICLQVCPVEG
AILPEERPDLQKSPA
NT seq 228 nt   +upstreamnt  +downstreamnt
atgccccataccattgttacggaaacctgcgaaggcgtggccgactgcgttgaagcctgc
cccgtagcctgcattcaccccggagacgggaaaaacaccattggcaccgattggtactgg
attgactttgccacctgcatcgattgcggcatctgcctccaagtttgcccggtggaaggg
gccattctgccggaggaacggcctgatttacagaaaagccctgcctag

DBGET integrated database retrieval system