KEGG   Synechocystis sp. PCC 6803: ssr5092Help
Entry
ssr5092           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAD01862
CyanoBase: ssr5092
UniProt: Q6ZEN8
Position
pSYSM:90973..91218
Genome map
AA seq 81 aa AA seqDB search
MINQAIQLAQLFGNLLTMADYSMACALLSPERQRQYPPMEPNDVVWLYVSLEGEDFVEAV
SVIIEDREGKLAIRWLEWGRP
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccaagctattcaattagcccaactatttggcaatctcttaactatggccgat
tacagcatggcttgcgctttgctatccccggaacggcaacggcaatatccacccatggaa
ccgaatgatgtcgtctggttatacgtttctttagagggggaagattttgtggaggctgta
tcggtgattatcgaagatcgggaaggaaaattagcaattcgttggcttgagtggggtagg
ccctga

DBGET integrated database retrieval system