KEGG   Synechococcus sp. KORDI-52: KR52_03965Help
Entry
KR52_03965        CDS       T03346                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00520  Amino sugar and nucleotide sugar metabolism
synd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KR52_03965
Enzymes [BR:synd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     KR52_03965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AII48312
UniProt: A0A076HHX6
Position
complement(766364..767551)
Genome map
AA seq 395 aa AA seqDB search
MAAEASVALMHRITNVRLPGPLPGDGDQRYSVDLDEQGLICRIDAMGADAQQEAQQPYAD
WNGDWLSPRGVDLQINGGLGLAFPELSEMDLPRLEELLELLWRDGVEAIAPTLVTCGIAP
LRQALDVLRQARQQHRRGRCRLLGAHLEGPFLAETRRGAHPREHLARPSLEALNERIGGF
ETEIALVTLAPELEGAAAVIGRLRDLGISVALGHSAANAEQASAGFDQGVAMLTHAFNAM
PGLHHRAPGPLGEACRRGGIALGLIADGVHVHPTMAVLLQRLALEQTVLVSDALAPYGLA
DGEHRWDERLLLVEKGTCRLEDGTLAGVTLPQLEGVKRLARWSDAPSAAIWSATVAPRRV
IGDATGCMDALMGRPLTQLLRWHQKEGDLHWACAA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaagccagtgttgcgttgatgcaccgaatcaccaacgttcgactgccgggt
cccctgcctggggacggagaccagcgctattccgtcgacctcgacgagcaggggctgatc
tgccgcatcgacgcgatgggcgccgatgcgcaacaagaggctcaacaaccctatgcggac
tggaacggcgactggctcagcccccggggtgttgacctgcagattaacggcgggttggga
ctggccttcccggaactgagcgagatggatttgccccggctggaggaactcctcgagctg
ttgtggcgcgatggggtcgaagcgatcgccccgaccctggtgacctgcggcatcgcgccg
ctgcgccaagccctggacgtgctgcggcaggcgcggcagcaacaccggcgcggccgttgc
cggctgctgggggcccatctggagggtccatttctggcagagacccgccgcggtgcccat
ccccgtgaacacctggcccgccccagcctggaggccctgaacgaacgcattggtgggttc
gaaacggagattgccctggtgaccctggctcccgaactggagggggccgctgcggtgatc
gggcggctgcgggacctgggcatcagcgtggctctcggccacagcgccgccaatgccgaa
caggccagcgccggtttcgatcagggggtggccatgctcacccacgccttcaatgccatg
ccggggttgcaccaccgggcgccaggccctctcggtgaggcctgccggcgcggaggcatt
gccctaggcctgattgccgatggcgtgcacgttcaccccacgatggcggtgctgttgcaa
cggctggcgctggagcagacggtgctggtgagcgatgcgctagccccctacggcctggcc
gatggggagcaccgctgggatgagcggttgctgctggtggagaaaggcacctgccggctc
gaagacggcaccctggcgggggtgaccctgccgcaactggagggggtgaaacggctggcc
cgctggagtgacgcccccagtgctgcgatctggagcgccacggtggcgccgcggcgggtg
attggcgatgcaacggggtgcatggatgccctgatgggacggccactgacgcagctgctg
cgctggcaccagaaggagggtgatctgcactgggcctgcgctgcttag

DBGET integrated database retrieval system