KEGG   Synechococcus sp. KORDI-52: KR52_06440Help
Entry
KR52_06440        CDS       T03346                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:synd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KR52_06440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:synd01007]
    KR52_06440
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:synd03016]
    KR52_06440
Enzymes [BR:synd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     KR52_06440
Amino acid related enzymes [BR:synd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   KR52_06440
Transfer RNA biogenesis [BR:synd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    KR52_06440
 Prokaryotic Type
    KR52_06440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AII48779
UniProt: A0A076HMJ0
Position
complement(1215121..1216602)
Genome map
AA seq 493 aa AA seqDB search
MSLRFTNSLTSRTEAFEPLTEGKASIYCCGVTVYDLCHLGHARSYINWDVLRRYLIWRGY
DVTYVQNYTDIDDKILNRANEEGITMQAVSERNIEAFEIDMGRLNILPADRMPRATSCIE
GIQTLISELETKGAAYSSDGDVYFDISKARNYGKLSGRDPNDQQQGASGRTADGEESRKR
HPFDFALWKGAKAGEPSWDSPWGPGRPGWHIECSAMVRQELGQTIDIHLGGGDLVFPHHE
NEIAQSETANGTTLAKLWMHNGMVNVGGTKMSKSLGNFTTIRALLDSGISPMTLRLFVLQ
AHYRKPLDFTAEALEAAATGWKGLNAALSLGDRHGDSLDWSTAAALTEGAMTADGDLADT
ALVELEQRFISAMDDDLNSSGGLAVLFDLAKPLRALANRLERGEDAALPEAELIGLEGRW
QLLRHLAAVLGLRAEAEAASNLDDGAIDAAITARKAAKAAKNYAEADRIRDELTAQGVEL
IDKPGGVTEWIRA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgcgcttcaccaacagcctcaccagccgcaccgaagcgttcgagcccctcacc
gagggcaaagccagcatctattgctgcggcgtgacggtctacgacctctgccacctaggc
catgcccgcagctacatcaactgggatgtgctgcgtcgttatctgatctggcgcgggtac
gacgtcacctacgtccagaactacaccgacatcgacgacaagatcctcaatcgcgccaat
gaggagggcatcacgatgcaggcggtgagcgaacgcaacatcgaagcgttcgagatcgac
atggggcgcctgaatatcctcccagccgaccgaatgccaagggccacaagctgcatcgaa
ggcatccagacactgatcagcgaactggaaaccaaaggagccgcctacagctcggatggt
gatgtctacttcgacatttccaaggccaggaattacggcaagctcagcggccgcgacccc
aacgaccagcagcagggagccagcggtcgaaccgccgatggagaggaaagccgcaagcgt
catccctttgatttcgcgctttggaaaggggccaaagccggagaacccagctgggactcc
ccctgggggccaggccgcccgggctggcacatcgaatgctcagcgatggtgcgccaggaa
ctggggcaaaccatcgacattcacctcggtggcggagatctggtgttcccgcaccacgag
aacgagatcgctcagtcggaaaccgccaatggcacaaccctggcgaagctgtggatgcac
aacggcatggtcaatgtcggtggcaccaagatgtccaaatcgctcggcaacttcaccacc
atccgcgccttgctggacagtggaatctcgccgatgaccctgcgcctgtttgtgctgcag
gcgcactaccgcaaaccacttgatttcaccgccgaggcccttgaggccgcagccaccggc
tggaagggtctgaatgcagccctgagccttggcgatcgccatggcgacagcctggactgg
agcacagccgcagcgctcacggagggcgccatgacggcggatggagatttagccgacacc
gctctggtggagctggagcaacgcttcatcagcgccatggacgatgacctcaacagctcg
ggcggactggccgtgctcttcgatctggccaagcccctccgggccctcgccaaccggctg
gaacggggggaagatgctgccctgcctgaggcggagttgatcggtctggaggggcgctgg
cagctgctgcggcacctggcggcggtgctgggactgcgcgcggaagccgaagcagcatcc
aacctcgacgacggcgccattgatgcagccatcacggcgcgcaaggccgcaaaagccgcg
aagaattacgccgaggccgaccggatccgggatgaactcacggcccagggggtggagctg
atcgacaaacccggtggggtgacggagtggatccgggcctga

DBGET integrated database retrieval system