KEGG   Synechococcus sp. KORDI-52: KR52_07960Help
Entry
KR52_07960        CDS       T03346                                 

Definition
(GenBank) ATPase AAA
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:synd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KR52_07960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:synd03400]
    KR52_07960
Enzymes [BR:synd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KR52_07960
DNA repair and recombination proteins [BR:synd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     KR52_07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 AAA_30 AAA_25 ResIII
Motif
Other DBs
NCBI-ProteinID: AII49074
UniProt: A0A076HND4
Position
1481806..1485414
Genome map
AA seq 1202 aa AA seqDB search
MAQRFDANTYPLDPGVRLLEASAGTGKTFALAHLCLRLITEADHALEALLVVTFTDAAAE
ELRSRIGQRLQQALQGLEQLDQGMETSAPDPVLADWLGGSEPGEARQRWIRHLLVALEQL
DRADITTIHGFCRRSLRRLALSNAAAMEPQLDTDATALQAEVVQDLWQQELLSLPPDQFK
ALRQRGLSPQTLRRGLAQLDGEQQPWFRGADGAIDLDQPLAPQLEHWLAQLWHDFVPLWQ
RDHAALDAGFRQAAEQWKAQGCGATTPYSAKPKSDRCAQINQWLDGQTSVPSLLEIAARE
KPLKEYFHPGSWCKVARKCGETDPSLVTPALQAAVAALWDAPIERTWQYLLERGLQELDR
RRRRRGVITFGGLLASMDPGDGDVAWLAPLQQRYRAVMVDEFQDTDPVQWRLLQRAFGAG
ERHLLLMVGDPKQAIYRFRGGDLATYMAARDQVERIDHLLDNFRTTAPLMEGLNRLMAPG
LPRSELPVPAVQPRSSATPPQDAPALQLLLLSTEAPSSRSALEAELPQRLAAMVLEQLQQ
REDLTPADLCVLVSRHQQAEDLRRALGVCGLPTRLVTQGDVLDSEAALLLQWFLDALAEP
GDDARLRLLACSGLMNIAPDALEPGRLDQLALQLRGWADEIPRLGLLGALADLLKGEQMA
GLSERGRMLGDLQQAARLVQEAMHRQGLDVATAADWLRRERLHPSQPVPEARQPHSDQAD
SAIAVVTVHRSKGLEYPVVICPYLWQSPPAVAGPLWRDPRSGECLARVDVHWGEGWQAAQ
QAQQDAAAEAERLAYVAVTRAQTQLILIWARANGQEDSPLPAWLFGAEAAGDAIDSLTDE
RLSQALAERQVPISIDGLVESLPSGRRWRPPLLAEPLALGSIPKRIDRSWGRASYSAWIA
SSDDVQLHEQGRDRDPGAEESILVGAEPAWSETGPLAAFPRGAGAGDCLHRILEQFPFSE
AEAAEPRQRLELIAAELRRAGLDPDLQNDVLTGLEQVLQTPLGGPLGALSLDRLGPHQRL
PELSFDLPVQHVRTADLVAAFGCDAEARFGRTYSPALASLAINSRGFLTGSIDLVFQDPQ
HQRWWVLDWKSNWIGERRTSTELGLCGPHHYSQEAMEEQMLHHHYPLQAHLYLVALHRHL
RWRLPDYNPQQHLGGYVYCFLRGMPGALAASPEGAVGPGRIVEPVPLHRIAALDRALGEV
PA
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcgcttcgatgccaacacctatcccctcgaccctggggtccgcctgcttgag
gccagcgctggcaccggaaaaacctttgccctggcgcatctctgtctgcggctgattacg
gaggccgaccacgccctcgaggcgttgttggtggtgaccttcaccgatgcggcggctgaa
gagctgcgctcacgcatcggccagcggctgcaacaggcgttgcagggcctcgagcagctt
gaccaggggatggagacttctgctccggaccccgtcctggcggactggctggggggttcc
gagccaggggaggcgcgtcagcggtggattcggcacctgctggtggccctcgagcagttg
gaccgggccgacatcaccaccatccatggcttctgtcgccgcagcttgcgccgtctggcc
ctcagcaacgctgcggcgatggagccccagctggacaccgacgccaccgcgctccaagcc
gaggtggtgcaggacctctggcaacaggagctgctcagcctgccgccggatcagttcaag
gcgttgcgtcaacgcggcctctcgccccagaccctgcgcagggggttggcgcaactcgat
ggcgaacagcagccgtggttcaggggcgctgatggggcgatcgatctggaccagcccctc
gccccgcagctggagcactggctggcgcagctctggcacgacttcgtgccgctctggcag
cgggatcatgccgctctggatgccgggttccgtcaggcggccgagcagtggaaagcccag
ggctgtggagccaccaccccttattccgccaagcccaagagcgatcgctgcgcccagatc
aaccagtggctggatgggcagacctcagtgccatcgctgctggagattgccgcccgtgag
aagccgctgaaggagtacttccaccccggcagttggtgcaaggtcgcgcgcaagtgcggt
gagaccgaccccagcctggtgacgccggctcttcaggccgccgttgcggcgctctgggat
gcaccgattgagcgcacctggcaatacctcctggaacggggcttgcaggagctggaccgc
cgccgtcgccgccgcggggtgatcaccttcggcggcttgctggcctctatggatcccggc
gatggcgatgttgcctggcttgcccctctgcaacagcgctaccgggctgtgatggtggat
gagtttcaggacacagaccccgtgcagtggcgcctgttgcagcgcgccttcggtgctggt
gaacgccacctgctgctgatggtcggggaccccaagcaggcgatctaccgcttccgtggt
ggtgatctggctacctacatggcagcgcgggatcaggtggagcggatcgatcacctgctc
gacaacttccgcacaacggcaccgctgatggaggggttgaaccgcttgatggctccgggt
ctcccccgatctgaactgccggtgcccgcggtgcagcctcgcagctccgccaccccaccg
caggatgccccggcgttgcaactgctgctgctgtccacagaggcgccctccagccgcagt
gccctggaggcagagctgccccagcggctcgccgcgatggtgctggagcaactgcaacaa
cgggaggacctcacccccgcagatctctgcgtgctggtgagtcgtcatcaacaggcggaa
gaccttcgccgcgcccttggggtctgcggactccccacccgcctggtgacccagggggat
gtgctcgacagtgaagccgccttgctgttgcagtggttcctcgatgccctggcggaaccg
ggtgatgacgctcgcctgcgcctgctggcctgctcgggactgatgaacattgcgcccgat
gccctggagccggggcggttggatcagctggcgctgcagttgcgcggttgggctgatgag
attccgcggctgggcctgctcggggcgctggccgatctgctcaagggcgaacagatggcg
gggctgtcggaacggggccgaatgctgggggatctgcagcaggcggcgcggctggtgcag
gaggcgatgcaccgtcaggggcttgatgtggccactgcggcggattggttgcggcgggag
cggttgcaccccagccagccggtgccggaggctcgtcagccccacagcgatcaggccgac
agcgccatcgccgtggtcaccgtgcaccgcagcaagggtctggaatatccggtggtgatc
tgcccctacctctggcagtcgcccccagccgtggccggcccgctctggcgtgacccccgc
tcaggagagtgtctggcgcgggtggatgtccactggggggagggctggcaggcggcgcaa
caggcgcagcaggacgctgcggccgaggccgagcggctggcttatgtcgcggtgacccga
gcccaaacccagttgatcctgatctgggccagggccaacggccaggaggattccccgttg
cctgcctggttgttcggtgctgaggccgctggggatgcgatcgatagcctcaccgatgag
cggctgagccaagccctggcggagcgacaggttccgatcagcatcgatggcctggtcgag
agcctgcccagcggcaggcgttggcggcccccgctgctggctgagcccttggcccttggt
tccatccccaagcggatcgaccggagttggggccgggccagttactcggcctggattgcc
tcatccgacgacgttcagctgcatgaacagggtcgcgatcgcgatcccggcgctgaggaa
tcgatcctggtcggggcagaaccggcatggtccgagacagggccgctggcggctttcccg
cgcggggccggggccggggactgtctgcaccggatcctcgaacagttccccttttctgag
gcggaggccgctgagccccgccaacggctcgagctgatcgccgccgagttgcgccgggcc
ggacttgatcccgatcttcagaacgatgtgttgaccgggttggagcaggtgttgcagacg
cccctggggggaccgctgggtgcattgtcgctggatcggctggggccgcaccagcgcctg
cctgaactcagttttgacttaccagtgcagcatgtgcgcacggccgatctggtggccgcc
ttcggttgtgatgccgaggcccgtttcggccgcacctacagcccggcgctggcgtcgctc
gcgatcaacagtcgcgggtttctcaccggttccatcgatctggtgttccaggacccccag
caccaacgctggtgggttctcgactggaagagcaactggatcggtgaacggcgcaccagt
actgagctgggactctgcggaccgcatcactactcccaggaggcgatggaggagcagatg
ttgcaccaccactaccccctgcaggcccacctctacctggtggccctgcaccgccatctg
cgttggcggctgccggattacaacccgcagcagcatctggggggctacgtctactgcttc
ctgcgggggatgcctggagcgttggctgcttctccagaaggtgctgtcggaccggggcgc
atcgttgaacccgtgcccctccatcgcatcgcagccctggatcgagctctgggggaggtg
ccggcgtga

DBGET integrated database retrieval system