KEGG   Synechococcus sp. KORDI-52: KR52_12315Help
Entry
KR52_12315        CDS       T03346                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00220  Arginine biosynthesis
synd01100  Metabolic pathways
synd01110  Biosynthesis of secondary metabolites
synd01130  Biosynthesis of antibiotics
synd01230  Biosynthesis of amino acids
Module
synd_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    KR52_12315
Enzymes [BR:synd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     KR52_12315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N PALP
Motif
Other DBs
NCBI-ProteinID: AII49914
UniProt: A0A076HR29
Position
complement(2178799..2179755)
Genome map
AA seq 318 aa AA seqDB search
MATASAGVAAVLSPLCGRDFLSSADCSAEQTAALLDLAAQLKSGDRRIDLGNRVLGLIFS
KASTRTRVSFQVAMARLGGQTVDLNPSVTQLGRGEPLEDTSRVLSRYCDVLAIRTFAQQE
LVDYAHWASVPVINALTDLEHPCQALADFLTMQEAHGALPGQTLAYVGDGNNVAHSLMLC
GALLGVNVRIGCPEGFEPLPGVLEQAQSLAQHGASIELVADPGEAVAGAQAVYTDVWASM
GQEAEQAQREQAFAGFCVDQALMDQAAADAIVLHCLPAHRGEEISAEVMEGTASRIFDQA
ENRLHAQQALLAVLMGGL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcttctgcgggcgttgctgctgtcctgtctccgctgtgcggacgtgatttt
ctgtcctcagcggattgctccgctgagcagacagcagcgttgctggatctggctgcacaa
ctgaaaagcggtgatcgtcggatcgatctcggcaaccgtgtgctgggtctgatcttcagt
aaggcctccacacgcacccgtgtcagttttcaggtggccatggcccgtcttggcggccag
acggtggatctcaatccttccgtcacccagctcggccgcggcgagcccctggaagacacg
tcccgggtgctcagccgttactgcgatgtgctggcgatcagaaccttcgcccagcaggaa
ctggtggactatgcccactgggcatcggtgccggtgatcaatgccctcaccgatctggag
catccctgtcaggccctggcggacttcctcaccatgcaggaagcccatggcgctcttccc
gggcagaccctggcctatgtgggcgatggcaataacgtcgcccactccctgatgctctgc
ggtgccttgctgggggtgaatgtacggattggctgccctgaaggtttcgagccgttgccg
ggcgtgcttgaacaggcccaatccctggcacagcacggtgcctcgatagagctggtggcc
gatcccggtgaggcggtggcgggtgcccaggccgtgtacaccgatgtctgggcctccatg
ggtcaggaggccgagcaggcccagcgggagcaggccttcgccggtttctgtgtggatcaa
gctctgatggatcaggcagctgccgatgccatcgttctgcactgtctgccggcccaccgc
ggtgaggagatcagcgctgaggtgatggagggaacggcgagccgcatttttgatcaggcc
gaaaatcgtctgcatgcgcagcaggctctgttggcggttttgatgggtggtctgtga

DBGET integrated database retrieval system