KEGG   Synechococcus sp. KORDI-52: KR52_13045Help
Entry
KR52_13045        CDS       T03346                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00020  Citrate cycle (TCA cycle)
synd00620  Pyruvate metabolism
synd01100  Metabolic pathways
synd01110  Biosynthesis of secondary metabolites
synd01120  Microbial metabolism in diverse environments
synd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KR52_13045
   00620 Pyruvate metabolism
    KR52_13045
Enzymes [BR:synd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     KR52_13045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AII50052
UniProt: A0A076HNA3
Position
complement(2323645..2325153)
Genome map
AA seq 502 aa AA seqDB search
MQHDGSFNPEARYDAVLVGAGIMSATLAALLHELDPQLRLLLVERLEAPALESSAAVNNA
GTGHAANCELNYTPMQADGTVATAKAVAINASFERSLEFWSSLQERGDLDTSSFLHQAAH
ISAVWTPENIAFLRQRYSQLKDLSAFARMRWSEDQSELTEWMPLVMAGRDLKQPVAATRI
DRGTDVDFGTLTRAYLMPLQQSGTLTVVYGSQVQDLKRLRRSDMTEADWRVVLKGPSGKK
EVRAPFIFLGAGGGALPLLQRSGIPEAADFAGFPVSGLWLVCGDAQLADRQRAKVYGKAA
VGAPPMSVPHLDTRWIDGKRSLLFGPFAGFSSKFLKQGSLLDLPSSVRATNLVPMLQVGA
TNLELVQYLINQLRQSPAERHEALQQFMPTARAEDWTLSVAGQRVQIIKRSKQGGRLQLG
TEVVASGDGSLAALLGASPGASTAVTIMLEVLQRCFKQRLDSDAWQQRLQALLPSIHDDP
QQDPEVLNRMRERSDALLGLTA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgacggttcgttcaacccagaggcccgttacgacgccgtgctggtgggtgcc
ggaatcatgagcgccaccctggcggcgctgctgcatgaactcgatccgcagctgcgattg
ctgttggtggagcgcctcgaagcgcctgccctggagagcagcgcggctgtgaacaatgcc
ggcaccggccatgcagccaactgtgagctgaactacaccccgatgcaggcggatggcacc
gtcgcgacggccaaagctgtggccatcaatgcctcgtttgaacgaagcctagagttctgg
agctcgctccaggaacggggtgacctcgacaccagcagcttcctccaccaggcggcccac
atcagtgccgtgtggacgccggagaacatcgcctttctgcgtcagcgttacagccaactg
aaggacctgtcggcctttgcgcggatgcgttggagcgaagaccagagcgagctcaccgaa
tggatgcccctggtgatggcgggccgtgatctcaagcagccggtggcggccacccggatt
gatcgaggcaccgatgtggacttcggcaccctcacccgggcctacctgatgccgttgcag
cagagcggaacgctcactgttgtctatggctctcaggtgcaggacctcaaacggctgcgc
cgcagcgacatgaccgaggccgactggcgtgtggtgctcaaggggccctccggcaaaaaa
gaagtgcgggccccctttattttccttggtgctgggggtggtgccctgccgctgctgcaa
cgctccgggattccagaggcggctgatttcgcgggcttcccggtgagtggcctctggctc
gtttgcggtgatgcccagctggccgatcgtcagcgggccaaggtctacggcaaggcagcc
gtgggggccccaccgatgtcggtcccccacctcgacacccgctggatcgatggcaagcgc
tcgctgctgttcggcccgtttgcgggcttcagtagcaaattcttgaagcagggctccctg
ctggatctcccctcttccgttcgtgccaccaatctggtgccgatgctgcaggtgggcgcc
accaatctcgaactggtgcagtacctgatcaatcagctgcgccaaagccctgccgagcgg
catgaggcgctgcagcagttcatgcccaccgctcgcgctgaagactggaccctgtcggtg
gccggccagcgggtgcagatcatcaaacgcagcaagcagggcggacggctgcagctgggc
actgaggttgtggcctccggtgatggctccctggcggcgctgctgggggcctccccggga
gcgagcacagcggtgacgatcatgttggaggtgctgcagcgctgtttcaagcaacggctc
gacagcgacgcctggcagcaacggctgcaagcgctgttgcccagcatccatgacgacccg
cagcaggacccggaggtgttgaaccggatgcgggaacgcagcgatgccctgctggggctc
accgcctga

DBGET integrated database retrieval system