KEGG   Synechococcus sp. KORDI-52: KR52_13610Help
Entry
KR52_13610        CDS       T03346                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00790  Folate biosynthesis
synd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KR52_13610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:synd04147]
    KR52_13610
Enzymes [BR:synd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     KR52_13610
Exosome [BR:synd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KR52_13610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AII50161
UniProt: A0A076HL00
Position
2424186..2424476
Genome map
AA seq 96 aa AA seqDB search
MPVERLDAAQKSALTTALPNWVVNGDRLHLDLQFNSFVEAFGFMAQVALLAESKNHHPNW
SNVYNRVSIDLTTHDLGGLSSLDVELAAAINALLPA
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgaacgtctcgacgctgcccagaagtcggcactcaccacagccctgcctaat
tgggttgtgaacggagacaggctgcacctcgatctgcagttcaacagcttcgtggaggcc
tttggattcatggcacaggtggccttgctggccgaatccaaaaatcaccatccgaactgg
agcaacgtctacaaccgcgtttcgatcgacctgaccacccatgatctcggcggcctcagc
agccttgatgttgagctggctgccgcaatcaacgcgctgctgccagcatga

DBGET integrated database retrieval system