KEGG   Synechococcus sp. KORDI-52: KR52_13775Help
Entry
KR52_13775        CDS       T03346                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
synd  Synechococcus sp. KORDI-52
Pathway
synd00860  Porphyrin and chlorophyll metabolism
synd00970  Aminoacyl-tRNA biosynthesis
synd01100  Metabolic pathways
synd01110  Biosynthesis of secondary metabolites
synd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:synd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KR52_13775
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KR52_13775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:synd01007]
    KR52_13775
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:synd03016]
    KR52_13775
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:synd02048]
    KR52_13775
Enzymes [BR:synd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     KR52_13775
Amino acid related enzymes [BR:synd01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   KR52_13775
Transfer RNA biogenesis [BR:synd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KR52_13775
 Prokaryotic type
   Other AARSs
    KR52_13775
Prokaryotic defense system [BR:synd02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    KR52_13775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AII50191
UniProt: A0A076HL25
Position
2447609..2449042
Genome map
AA seq 477 aa AA seqDB search
MVRVRLAPSPTGTLHIGTARTAVFNWLYAKHEQGTFVLRIEDTDKERSKPEYTENILEGL
KWLGLNWDEEPVVQSERVTQHREAIQTLLDRGLAYRCYASESELTAMREAQKAANQAPRY
DNRHRHLTQDQEQAFQAEGREAVIRFRIDDAAEIRWNDLVRGAMSWRGVDLGGDMVIARR
APADEIGNPLYNLVVVVDDAAMEITHVIRGEDHIANTAKQLLLYEALGLPLPTFAHAPLI
LNAEGRKLSKRDGVTSINDFRAMGYTPDAIANYMTLLGWSVPEGMEERFSLSEAAAVFGF
DRVNKAGARFDWDKLNWLNAQVLHDWPAAQLLDELTPLWAERGWTPPSDTSWCLDLCALL
GPSLTLLKDGVDQAEPFFDCPDLQKDALEQLAIEGAKAAIADLLQRLENNSWDGSDSDQA
KAWLGEAAKAAGVKKGVVMKSLRAALLGRLQGPDLITTWSLLARIGEDVPRLRRCLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcgttcgattggcccccagcccaacgggcacgcttcatatcggcacggcacgc
accgcagttttcaactggctttacgccaagcatgaacagggaacattcgtgcttcgtatt
gaagacaccgacaaggagcgatccaaacccgagtacaccgagaacatcctggagggattg
aagtggctcgggctcaactgggatgaagagcccgtcgttcaaagcgaacgggttacacag
catcgcgaagcgattcagacccttctcgaccgtggattggcctaccgctgctacgccagc
gaatcggaacttacggctatgcgcgaagcgcagaaagctgccaatcaagctccgcgctac
gacaaccgccacagacacctgacacaggatcaggagcaggccttccaggctgaaggccgt
gaagcggtgatccgctttcgcattgatgacgcagcggagatccgctggaacgatctggtg
cgtggagccatgagctggcgtggcgtcgatcttggcggtgacatggtcatcgcccgtcgc
gctcctgccgatgagatcgggaaccccctctacaaccttgtggtggtcgtggatgacgcc
gcaatggagatcacccatgtgatccgcggcgaagaccacatcgccaacacggccaagcaa
ctgcttctctacgaagcgctaggcctgcccttgcccacctttgctcacgctcccctcatt
ctcaacgccgagggacgcaaactgtccaaacgagatggtgtgacttcgatcaacgacttc
cgcgccatgggctatacccctgatgccattgccaactacatgacgttgttggggtggtct
gtaccggagggtatggaagagcggttcagcctcagcgaggctgctgccgtctttggtttc
gaccgtgtcaacaaagcgggggcgcgttttgactgggacaaactcaactggctcaatgcc
caggttctgcatgactggccggcagcgcagctcttggatgaactaacgcccctctgggct
gaacgcggatggacaccacccagcgacaccagctggtgcctcgacctctgtgccttgctg
gggccctccctcaccttgctcaaagatggcgtcgaccaagcggaaccgttctttgactgc
cctgatctccagaaggatgcgcttgagcaactcgcgatcgaaggagccaaagcagccatt
gccgacctgcttcagcggctcgaaaacaattcttgggatggaagcgacagtgatcaggcc
aaggcctggttgggggaagccgccaaggctgctggcgtgaaaaaaggtgtggtgatgaag
tccctacgcgctgcgcttctgggacgtcttcagggacctgatctgatcaccacgtggtcc
ctactggcgcgaatcggtgaggatgtcccgcgtctgcgccgttgcctcagctga

DBGET integrated database retrieval system