KEGG   Synechococcus sp. PCC 6312: Syn6312_1582Help
Entry
Syn6312_1582      CDS       T02370                                 

Definition
(GenBank) ferredoxin protochlorophyllide reductase subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00860  Porphyrin and chlorophyll metabolism
syne01100  Metabolic pathways
syne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syn6312_1582
Enzymes [BR:syne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Syn6312_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red PrpR_N
Motif
Other DBs
NCBI-ProteinID: AFY60743
UniProt: K9RTE7
Position
complement(1563146..1564672)
Genome map
AA seq 508 aa AA seqDB search
MKLAYWMYAGPAHIGTLRIASSFKNVHGIMHAPIGDDYFNVMRSMLERERNFTPVTTSVV
DRHVLSRGSQEKVVDNITRKDSEEHPDLIVLTPTCTSSILQEDLENFVERASQTTVSDVI
LADVNHYRVNELQAADRTLEQIIQFYIAKARKNGDLVTAKTPEPSVNILGPTTLGFHNQH
DVRELRKLMADLGITINAVIPDGASVNDLKTLPQAWFNLVPYREIGPLTARYLQQEFNQP
FVDITPMGVVETARCIRQIQTLLNQQGATVNYEDFIQSQTLHVSQAAWFSRSIDCQNLTG
KKAVVFGDNTHAAAITKILSREMGIHVAWAGTYCKYDGDWFREQVKDFCDEVIITDDHGA
IGDAIARVEPAAIFGTQMERHVGKRLDTPCGVIAAPIHIQNFPIGYKPFLGYEGSNQIVD
LIYNSFTLGMEDHLLEIFGGHDTKEVIHKGISADSDLNWTSDGLAELNKIPGFVRSKVKR
NTEKFARERNISHINVEVLYAAKEAVGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagttggcgtattggatgtatgcaggcccggcccacattggcaccttacgaattgcc
agttcgttcaaaaatgttcacggaattatgcacgcgcccattggtgatgattatttcaac
gtcatgcgctcgatgctggaacgggagcgaaactttaccccagttaccaccagcgttgtg
gatcgccatgtcctctctcgcggttcccaagaaaaggttgtggataacatcacccgtaaa
gatagcgaagaacaccccgacctcattgtcctcacccccacctgcacctccagcatcctc
caagaagatttagagaattttgtcgagcgggcctcccaaactacggtgtccgatgtcatt
ttggctgatgtcaatcactaccgcgttaatgaactccaggcagcggatcggacgcttgaa
caaattattcagttctatattgccaaagcccgcaaaaatggcgatctcgttacagcaaaa
actcccgaaccctccgtgaatatcctcgggccaaccacccttgggtttcataatcagcac
gatgtccgagaattacggaaactgatggctgacttggggattacaatcaacgcggtgatc
ccggatggagcttctgtcaatgatctgaaaactctcccccaggcctggtttaatttagtt
ccttatcgggaaattggccccttgacggcccgttatttacaacaggaatttaatcaaccc
tttgtggacattacgccgatgggggtggtggaaacggcccgctgtattcgccagattcaa
accctcctcaaccaacagggagccactgtcaattacgaagactttatccagtcccaaact
ctccatgtttcccaggccgcctggttttcccgctccattgactgtcagaatttaacgggt
aaaaaggccgttgtctttggggataatacccacgctgctgccattacgaaaatcctcagt
cgggaaatgggcattcacgtggcctgggccggaacctattgtaaatacgatggggattgg
ttccgggagcaggtgaaagacttctgtgatgaggtgattattaccgatgatcatggggcg
attggggatgcaattgccagggttgaacccgccgcgatttttggcactcagatggaacgt
catgttggcaaacgcttagatacgccctgtggtgtgattgctgccccgattcacattcaa
aacttcccgattggctacaaaccgtttctcggctatgaaggcagtaatcagattgtggat
ttaatctacaactcctttaccttggggatggaagatcatctcctagaaatctttggcggt
cacgataccaaggaagtgattcacaagggcatctctgccgattcggatctcaattggacc
agcgatggcctggcagaactgaataaaattccgggctttgtccgcagcaaggtcaaacgt
aatacggaaaaatttgcccgtgagcggaatattagccacattaatgtggaagtcctttac
gcagcaaaagaagcggtgggagcttaa

DBGET integrated database retrieval system