KEGG   Synechococcus sp. PCC 6312: Syn6312_1615Help
Entry
Syn6312_1615      CDS       T02370                                 

Definition
(GenBank) precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00860  Porphyrin and chlorophyll metabolism
syne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syn6312_1615
Enzymes [BR:syne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     Syn6312_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 PCMT Methyltransf_4 MTS GidB Cons_hypoth95 Methyltr_RsmB-F Methyltransf_25 UPF0020
Motif
Other DBs
NCBI-ProteinID: AFY60775
UniProt: K9RS37
Position
1605370..1605972
Genome map
AA seq 200 aa AA seqDB search
MAARNWPYVTPGIPDAYFERLPGIPLTHRETRLLVLAHLRLQANSVLWDIGAGTGTIPVE
AGLLSPQGQIVAVERDEEVAGLIRRNCDQFDLQNVEIVVDEAPACLASLSPTPDRVCLEG
GRPMKIILEQAWEFLAPGGRIVATASSLENLYALSEALATVQARSIEVVQSVINRLETRG
GHQIFAAVEPIFILSGEKLS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccgcaattggccctatgttacaccggggattccagatgcttattttgaacgc
ttgccgggaattcccttgacccatcgggaaacgcggttgttggtgctggcccatttacga
ctccaggccaattcggtgctttgggatattggggcggggacaggaaccattccagtcgag
gcggggttgttatctcctcaagggcaaattgtcgcagtcgagcgagatgaagaagtggct
gggttaattcgccgcaattgtgatcagtttgatttgcagaatgtcgaaattgttgtggat
gaagccccggcctgcctcgcctccttaagccccactccagatcgggtttgtttggaaggg
ggacggccgatgaagattattttggaacaggcctgggaatttttagcccctggtggtcga
attgtcgccactgccagcagtctcgaaaatttatatgccctctcagaagcccttgccacc
gtccaagcccggagcattgaagttgtccagtcggtgattaatcgtctcgaaacccgcggt
gggcatcagatttttgcagcagtagaaccgatttttatcctgagtggcgaaaagttaagc
taa

DBGET integrated database retrieval system