KEGG   Synechococcus sp. PCC 6312: Syn6312_2741Help
Entry
Syn6312_2741      CDS       T02370                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00250  Alanine, aspartate and glutamate metabolism
syne01100  Metabolic pathways
syne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Syn6312_2741
Enzymes [BR:syne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Syn6312_2741
Peptidases [BR:syne01002]
 Cysteine Peptidases
  Family C44
   Syn6312_2741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6
Motif
Other DBs
NCBI-ProteinID: AFY61822
UniProt: K9RXN3
Position
complement(2693910..2695940)
Genome map
AA seq 676 aa AA seqDB search
MTILGFSKLYGIFCGIWMSLSLLAFSHLLPPIITADAAPCPKITPMSSIFGLIHHQAPLN
PEYLGRMQTSMAYWGQDGSGLWSENQVGLGHLLRHNTPESVYEVLPRVSAGGLVITATAR
IDNRTELCQLLSIAPPEQAMTPDSELIIQAYEKWGLACVDRLLGSWAVAIWHPEQEKLWI
ARDACGTGGLYYTQQGGLFAFASSLKGILALPQVSRQPNLLEVAHVLTSWPSDGVQTCYE
NIFHLPPGHTLTLTQAELNIQRYWDIGHIQPLELSSSQAYLDAFLEVYTQAVTSNLRSFK
PVGATMSGGLDSGSVCALAAKQLRKRHQNLPVFTHVPLYDTQGITHPRRFGDESPFVEAN
RQFIGNVAVHYLRSEGITPLASLEQKLWINDQPSHAAANFFWMIDLLQTVQNMGLGTVLT
GQGGNATISWGGLPASWRTHVKEGNWDVLWSKVQRACVSPQQTLIRFLPKFLRPQSLAPT
SSEPVWLDYSAINSAWARSFQIDQKMAASGHDPTFQQSDLLAERRDLIRHTSQKANTLWQ
EMGAAYSVEVRDPTLDKRVIEFCLGIPTWVYRDRHLNRALIRQAMVGVLPDKVRLNQTKG
LQAADIAFRVRDHQDEIANALHQLSASPLAQEMLDLPKMQQVLASIQAEITQANSGDCGT
ILLRGLGCGLFLASFT
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgactattctgggcttttccaagctttatgggatattctgcggcatctggatgagcttg
tccctacttgcgtttagtcatttattaccgccgattattacagccgatgcagccccatgc
cctaaaattacgcccatgagtagtatctttggcctcatccatcaccaggccccccttaac
cctgaatatctaggtagaatgcaaaccagcatggcctattgggggcaagatgggtcggga
ctatggtcagaaaaccaggttggattggggcatcttttacgccataacaccccagaatca
gtttatgaagtcttacctagggtcagcgcggggggcctggtcatcactgccactgccagg
attgataatcggacagaactttgccaactcctgagcattgccccaccggaacaggcaatg
acccccgacagtgagttgattatccaggcctatgagaaatgggggctggcctgtgtggat
cgcttgcttggttcctgggcagtggccatttggcatcctgaacaagaaaaactctggatt
gcccgcgatgcttgtggcacaggtggactgtactacacccaacagggtgggctttttgcc
tttgccagttccctcaaaggaatattagccctgcctcaagtctctcgacaaccgaattta
ttagaagtggcccatgtgctcacctcctggcccagtgatggggtgcaaacctgctatgaa
aacattttccatctgcccccaggccacactctaaccttgacccaggctgaactaaacatc
cagcgatattgggatattggccatattcagccccttgaactaagttcctcccaggcctat
ttggatgcgttcttagaggtttatacccaggccgtgacaagcaatttacgcagtttcaaa
cccgtgggcgcgaccatgagcggggggctggattcgggttcggtctgtgccttagccgca
aaacaactccgaaaacggcatcaaaatttacccgtgtttacccatgtgcccctctatgac
actcaaggcattacccatccgcggcggtttggtgatgaatccccctttgtggaagcaaat
cggcaatttatcggcaatgtggcggttcactatttaagaagtgaaggtataacgcccctg
gctagcctggaacaaaagctctggatcaatgatcaacccagtcatgcggcggcaaacttt
ttttggatgatcgatctcttacaaaccgtgcagaacatgggcctgggaacagttttaaca
ggacaagggggcaatgccacgatttcttggggcgggttgcctgcctcttggcggactcat
gtaaaagaagggaactgggatgtcctgtggagcaaagttcagcgagcctgtgtatcccca
cagcaaaccttgattcgattcctgcccaaatttttgcggcctcagtctctcgcaccaaca
tcctctgaaccagtctggctagattactctgcgattaactcggcctgggcaaggtcattt
cagattgatcaaaaaatggctgcatccggccacgaccctacatttcaacagtcagatttg
ttagcggaacgccgtgacctgatccgacatacgagccaaaaagcaaataccctctggcaa
gaaatgggagccgcctacagcgttgaggttcgggatccgaccctggataaacgggtgatt
gaattttgtttagggattcccacctgggtctatcgagatcggcatctgaatcgggcttta
attcgccaggccatggtgggtgtgcttcccgacaaagtccgcctgaatcagactaaaggt
ttacaggccgctgatattgcctttcgggtgcgggatcatcaggatgaaattgccaacgcc
ttgcaccagttaagcgcatctcccctggcccaagagatgttagatttacctaaaatgcag
caagtattggcatccatccaggctgagattacccaagccaactctggagactgcgggaca
attttattgcggggcctgggttgcgggctgtttctggctagctttacataa

DBGET integrated database retrieval system