KEGG   Synechococcus sp. PCC 6312: Syn6312_3187Help
Entry
Syn6312_3187      CDS       T02370                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:syne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Syn6312_3187
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:syne03011]
    Syn6312_3187
Ribosome [BR:syne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Syn6312_3187
  Bacteria
    Syn6312_3187
  Archaea
    Syn6312_3187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: AFY62234
UniProt: K9RY77
Position
complement(3112684..3113052)
Genome map
AA seq 122 aa AA seqDB search
MATPTITRIGSKATARYVRMSPHKVRRVLDQLRGRSYREALIILRFMPYRACDPITKVLR
SAAANSEHNQGINPADLIVYEAFADQGPSLKRFRPRAQGRAYQIRKPTCHITISVAEAKS
EE
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccaaccatcactagaattggcagcaaggcgacagcccggtatgtgcggatg
tctccccataaagtccggcgggtcttagaccaattgcggggtcgctcctatcgggaagcc
ctgattatcttgcggtttatgccgtaccgggcctgtgatccgatcactaaggttttacgc
tcggcggcggccaactctgagcataatcaggggatcaatccggctgacttgattgtttac
gaagctttcgccgatcaaggtcctagcttgaaacggttcaggccacgggcgcaggggcgg
gcttatcaaatccgtaaaccaacttgccacatcaccatttctgtggccgaagcaaagtct
gaagagtaa

DBGET integrated database retrieval system