KEGG   Synechococcus sp. PCC 7502: Syn7502_01332Help
Entry
Syn7502_01332     CDS       T02371                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Syn7502_01332
Enzymes [BR:synp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Syn7502_01332
Transporters [BR:synp02000]
 Other Transporters
  Pores ion channels [TC:1]
   Syn7502_01332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AFY73425
UniProt: K9STF2
Position
complement(1358640..1359239)
Genome map
AA seq 199 aa AA seqDB search
MIKLYGHELSGNSYKVKLLLSLLHLEYEWIKVDLMQGEHKGEQHLARNPFGQVPVLIDGD
VTLADAQSILVYLARKYGGDRWLPLDAVALAQVVRWLSTAAGEVRQGTENARLYYLFGAT
NINIELATQKSGFILNQLDQHLSTRNWLEFEHPTIADIAIFPYIALAAGGKIDIKPYSHV
LAWIERVKQLSGFVAMVGI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattaagctctacggacatgaactttcgggtaacagctacaaagttaaattgcttctt
tccctacttcatcttgaatatgaatggataaaagttgatttaatgcaaggggaacataaa
ggtgagcaacatttagctcgaaatccctttggtcaagttcctgtgttgatcgatggtgac
gttactttagctgatgcccaatccattctggtctatttggcacgaaaatatggaggcgat
cgctggctccccttagatgctgtagccttagcacaagtagtacgttggctatctacggct
gcgggagaagtacggcaggggacagaaaatgcgcgactctattacctatttggggcgact
aatatcaatattgaactggctacgcaaaaatctggatttatcctcaatcaactggatcaa
catctaagtacaaggaattggttagaatttgaacacccgacaattgctgatattgctatt
ttcccgtacattgccctagctgctggtggcaagattgatattaaaccctattcccatgtt
ttagcttggattgaacgggttaaacagttatctggatttgtagcaatggtaggaatttaa

DBGET integrated database retrieval system