KEGG   Synechococcus sp. PCC 7502: Syn7502_02651Help
Entry
Syn7502_02651     CDS       T02371                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00010  Glycolysis / Gluconeogenesis
synp00052  Galactose metabolism
synp00500  Starch and sucrose metabolism
synp00520  Amino sugar and nucleotide sugar metabolism
synp00521  Streptomycin biosynthesis
synp01100  Metabolic pathways
synp01110  Biosynthesis of secondary metabolites
synp01120  Microbial metabolism in diverse environments
synp01130  Biosynthesis of antibiotics
synp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn7502_02651
   00052 Galactose metabolism
    Syn7502_02651
   00500 Starch and sucrose metabolism
    Syn7502_02651
   00520 Amino sugar and nucleotide sugar metabolism
    Syn7502_02651
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Syn7502_02651
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Syn7502_02651
Enzymes [BR:synp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Syn7502_02651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFY74610
UniProt: K9SWR2
Position
complement(2625625..2626686)
Genome map
AA seq 353 aa AA seqDB search
MKLLLTGDVGGTKTLLSLIKSVPNHQSETLHSDRFNSQNYSSLKDIIQQFFQEAAVKLGY
TPEVDTACFGIAGPVANNTSYLTNLGWQLNGNQLQTELGIEQVELINDFAAVGYGVLGLD
SADLYTLQVGERQPQAPIAVIGAGTGLGQGFLTWNYDHYQVYASEGGHTDFAPRSPREMA
LLNFLLTRHERVSTERVVSGKGIVSIYQFLKHNSPEPTELYQLLQAWEGGDHTIDMGAAI
AKATLNKTDEAAMETIQIFLDAYAAEIGNLALKLLPYGGLYIAGGITPKLLSLISSCEGS
GENNRFLHILKHKGRVSPMLDTIPIHIVLNQNVGLIGTILHGSYLQQARNKGK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttactaactggggatgttggtggcactaaaaccctgctaagtctaattaaa
tcagtcccaaatcatcagtccgaaactctccatagcgatcgcttcaacagtcaaaactac
agttcactcaaagatattattcagcaattcttccaagaagcagccgttaagctgggatat
actcccgaagttgatacagcttgttttggcatagcaggtccagttgctaacaatacttct
tacctcactaatctcggttggcaactaaatggtaatcaactgcaaacggaattaggaatt
gagcaagttgagttaattaatgactttgcggcggttggctatggggttttaggcttagac
agcgcagatttatatactttacaggtgggtgaacgtcaacctcaggctcccattgctgta
attggggcaggtacaggcttagggcagggtttcttgacatggaattatgatcactaccaa
gtctatgcttctgagggtggtcatacggattttgcaccacgatcgccaagggaaatggca
ctattaaattttttattaactcgccatgaacgggtatccacagaacgagtagtttcaggc
aagggcattgtttcgatttatcagtttttaaaacacaattctccagagcctacggagctg
tatcaactattgcaggcttgggaaggcggagatcacactattgatatgggagcagcgatc
gctaaggcgactttgaataaaactgatgaagcagcaatggaaaccattcaaatttttctt
gatgcctatgctgcggaaattggaaaccttgcccttaagcttctgccctacggtggtcta
tacattgcaggagggatcacgcccaagcttttatctttaatttcttcctgtgaagggtca
ggggaaaataacagatttctgcacattcttaagcataaaggacgagtcagccccatgctt
gacaccattcctatccatattgtccttaatcaaaacgtcggactaattggcactattctg
cacggctcttacctgcaacaagctagaaataaaggcaaatag

DBGET integrated database retrieval system